Rv2830c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2830c

Protein Domains

Gene Information
Locus	Rv2830c
Symbol
Gene Name	conserved hypothetical protein
Location	3137009 - 3137224 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:216 bp Protein:72 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9327
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2830c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2830c Transcript 1
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAADDDE
LFTTGVSWNVS*

Genomic Sequence

>Rv2830c
ATGACCGCTACGGAGGTGAAGGCGAAGATCCTCTCCTTGCTTGATGAAGTGGCCCAGGGC
GAGGAGATCGAGATCACCAAACACGGCCGCACCGTGGCCCGGCTGGTGGCAGCGACGGGG
CCGCACGCGCTGAAGGGTCGATTCTCGGGTGTGGCGATGGCGGCCGCGGATGACGACGAA
CTCTTCACCACCGGGGTTTCGTGGAACGTTTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Symbol	VapB	active	jlew	2012-03-07
	Rescues growth inhibition in MS authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB22	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Q06253 bacteriophage P1 phd gene (73 aa), FASTA scores: opt: 79, E(): 3.8, (35.9% identity in 39 aa overlap)
Other	stop:3137224	active	rslayden	2012-03-05
	Q06253 bacteriophage P1 phd gene (73 aa), FASTA scores: opt: 79, E(): 3.8, (35.9% identity in 39 aa overlap)
Other	start:3137009	active	rslayden	2012-03-05
	Q06253 bacteriophage P1 phd gene (73 aa), FASTA scores: opt: 79, E(): 3.8, (35.9% identity in 39 aa overlap)
Symbol	Vap BC-22	active	rslayden	2012-03-05
	Q06253 bacteriophage P1 phd gene (73 aa), FASTA scores: opt: 79, E(): 3.8, (35.9% identity in 39 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Rv0596c Hypothetical protein from Mycobacterium tuberculosis (85aa), FASTA scores: opt: 88, E(): 1.3, (41.7% identity in 36 aa overlap); and to PHD_BPP1
Other	stop:3137224	active	rslayden	2012-03-05
	Rv0596c Hypothetical protein from Mycobacterium tuberculosis (85aa), FASTA scores: opt: 88, E(): 1.3, (41.7% identity in 36 aa overlap); and to PHD_BPP1
Other	start:3137009	active	rslayden	2012-03-05
	Rv0596c Hypothetical protein from Mycobacterium tuberculosis (85aa), FASTA scores: opt: 88, E(): 1.3, (41.7% identity in 36 aa overlap); and to PHD_BPP1
Symbol	Vap BC-22	active	rslayden	2012-03-05
	Rv0596c Hypothetical protein from Mycobacterium tuberculosis (85aa), FASTA scores: opt: 88, E(): 1.3, (41.7% identity in 36 aa overlap); and to PHD_BPP1
Other	strand:+	active	rslayden	2012-03-05
	MTCY19H5.26
Other	stop:3137224	active	rslayden	2012-03-05
	MTCY19H5.26
Other	start:3137009	active	rslayden	2012-03-05
	MTCY19H5.26
Symbol	Vap BC-22	active	rslayden	2012-03-05
	MTCY19H5.26
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical protein, some similarity to Z97182
Other	stop:3137224	active	rslayden	2012-03-05
	Hypothetical protein, some similarity to Z97182
Other	start:3137009	active	rslayden	2012-03-05
	Hypothetical protein, some similarity to Z97182
Symbol	Vap BC-22	active	rslayden	2012-03-05
	Hypothetical protein, some similarity to Z97182