Rv2865 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2865

Protein Domains

Gene Information
Locus	Rv2865
Symbol
Gene Name	conserved hypothetical protein
Location	3177537 - 3177818 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:282 bp Protein:94 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9196
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2865
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2865 Transcript 1
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGI
RESIAEADADIASGRTYGEDEIRAEFGVPRRPH*

Genomic Sequence

>Rv2865
ATGCGGATACTGCCGATTTCGACGATCAAGGGCAAGCTCAATGAGTTCGTCGACGCGGTC
TCGTCGACACAGGACCAGATCACCATCACCAAGAACGGTGCACCCGCAGCCGTTCTGGTC
GGCGCCGACGAGTGGGAATCGTTGCAGGAGACGCTGTACTGGCTGGCGCAACCCGGAATC
AGGGAGTCGATCGCTGAAGCCGACGCCGACATTGCCTCCGGCCGCACCTACGGCGAAGAC
GAGATCCGCGCCGAATTCGGCGTCCCGCGACGCCCCCACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv2866	active	akvsangli	2012-10-05
	Spectrophotometric assay SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	InhibitedBy Rv2866	active	akvsangli	2012-10-05
	Spectrophotometric assay SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Symbol	relF	active	jlew	2012-03-07
	Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
Symbol	relB2	active	jlew	2012-03-07
	Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin. authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Symbol	relF	active	jlew	2012-03-07
	Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Symbol	RelB2	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTV006.19c HYPOTHETICAL 9.8 KDA PROTEIN from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap)
Other	stop:3177818	active	rslayden	2012-03-05
	MTV006.19c HYPOTHETICAL 9.8 KDA PROTEIN from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap)
Other	start:3177537	active	rslayden	2012-03-05
	MTV006.19c HYPOTHETICAL 9.8 KDA PROTEIN from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap)
Symbol	rel BE-2	active	rslayden	2012-03-05
	MTV006.19c HYPOTHETICAL 9.8 KDA PROTEIN from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	SAV2408 CONSERvED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247
Other	stop:3177818	active	rslayden	2012-03-05
	SAV2408 CONSERvED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247
Other	start:3177537	active	rslayden	2012-03-05
	SAV2408 CONSERvED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247
Symbol	rel BE-2	active	rslayden	2012-03-05
	SAV2408 CONSERvED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247
Other	strand:+	active	rslayden	2012-03-05
	SSR2754 HYPOTHETICAL 9.7 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570
Other	stop:3177818	active	rslayden	2012-03-05
	SSR2754 HYPOTHETICAL 9.7 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570
Other	start:3177537	active	rslayden	2012-03-05
	SSR2754 HYPOTHETICAL 9.7 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570
Symbol	rel BE-2	active	rslayden	2012-03-05
	SSR2754 HYPOTHETICAL 9.7 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570
Other	strand:+	active	rslayden	2012-03-05
	YR54_SYNY3
Other	stop:3177818	active	rslayden	2012-03-05
	YR54_SYNY3
Other	start:3177537	active	rslayden	2012-03-05
	YR54_SYNY3
Symbol	rel BE-2	active	rslayden	2012-03-05
	YR54_SYNY3
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing weak similarity with P58235
Other	stop:3177818	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing weak similarity with P58235
Other	start:3177537	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing weak similarity with P58235
Symbol	rel BE-2	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing weak similarity with P58235