Rv2866 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2866

Protein Domains

Gene Information
Locus	Rv2866
Symbol
Gene Name	conserved hypothetical protein
Location	3177822 - 3178085 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:264 bp Protein:88 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11551
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2866
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2866 Transcript 1
MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTY
RLLYRIDDEHTTVVILRVDHRADIYRR*

Genomic Sequence

>Rv2866
GTGCCTTACACCGTGCGGTTCACCACAACCGCGCGTCGAGACCTCCACAAGCTGCCACCG
CGCATCCTCGCGGCAGTGGTCGAATTCGCGTTCGGCGATCTGTCGCGCGAGCCCCTGCGG
GTGGGCAAGCCCCTTCGGCGCGAGTTGGCCGGCACGTTCAGCGCGCGTCGCGGAACGTAC
CGCCTGCTGTACCGGATTGACGACGAGCACACAACGGTAGTGATCCTGCGCGTCGATCAC
CGCGCGGACATCTACCGCCGATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv2865	active	akvsangli	2012-10-05
	Spectrophotometric assay SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	Inhibits Rv2865	active	akvsangli	2012-10-05
	Spectrophotometric assay SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	Regulatory Rv2053c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	Regulatory Rv2052c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Symbol	relG	active	jlew	2012-03-07
	Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
Symbol	relE2	active	jlew	2012-03-07
	RelE2 overexpression increased bacterial survival rates in the presence of rifampin in vitro, while deletion significantly decreased survival rates. Strikingly, deletion of this toxin had no discernible effect on the level of persisters seen in rifampin-treated mice.. Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin. authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Symbol	relG	active	jlew	2012-03-07
	Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Symbol	RelE2	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
Other	stop:3178085	active	rslayden	2012-03-05
	MTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
Other	start:3177822	active	rslayden	2012-03-05
	MTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Rv1246c
Other	stop:3178085	active	rslayden	2012-03-05
	Rv1246c
Other	start:3177822	active	rslayden	2012-03-05
	Rv1246c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O50461
Other	stop:3178085	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O50461
Other	start:3177822	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O50461