Rv2872 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2872

Protein Domains

Gene Information
Locus	Rv2872
Symbol
Gene Name	conserved hypothetical protein
Location	3183382 - 3183825 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:444 bp Protein:148 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9197
Related Genes	MT2939
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2872
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2872 Transcript 1
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEP
TSPQDAWQAVDALLAAPAAMRLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNA
TWLSADRGFARFRRLRWRHPLDGQTHL*

Genomic Sequence

>Rv2872
ATGCTGTGCGTTGATGTCAACGTGCTCGTTTACGCGCATCGGGCAGACCTACGGGAGCAC
GCGGACTATCGGGGTTTGCTTGAGCGGCTGGCCAACGATGACGAGCCGCTGGGTCTACCA
GATAGCGTGCTCGCCGGCTTCATCCGGGTGGTTACCAACCGCCGCGTCTTCACCGAGCCG
ACGAGCCCACAGGACGCATGGCAGGCAGTCGACGCCCTACTCGCGGCACCCGCAGCCATG
CGACTTCGGCCTGGCGAGCGCCACTGGATGGCCTTTCGGCAGTTAGCGTCCGATGTTGAT
GCGAACGGCAACGACATTGCGGACGCGCACCTGGCCGCCTACGCGCTAGAGAACAACGCA
ACCTGGTTGAGCGCCGACCGCGGCTTTGCCCGTTTCCGTCGACTGCGCTGGCGTCATCCG
TTGGACGGTCAGACCCATCTATAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2875	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2871	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	Inhibits Rv2871	active	akankshajain.21	2012-10-05
	Gene Neighborhood (Functional linkage) authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
Interaction	Inhibits Rv2871	active	akankshajain.21	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009