Rv2941 - fatty-acid-CoA ligase fadD28

Expression: Most Significant Conditions for Rv2941

Protein Domains

Gene Information
Locus	Rv2941
Symbol	fadD28
Gene Name	fatty-acid-CoA ligase fadD28
Location	3283335 - 3285077 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1743 bp Protein:581 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22144
Related Genes	ML0138 MT3011 MUL_2008
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2941
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2941 Transcript 1
MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGS
TGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVTDERSDSVLSDSSPVAILTTS
SAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAG
VVMSHQNVRVNFEQLMSGYFADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAV
LTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAG
HAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTVGEIWVHGDNVANGYWQKPDE
SERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEAT
IQEITRGRCAAISVPGDRSTEKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGL
SVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA*

Genomic Sequence

>Rv2941
ATGAGTGTGCGTTCCCTTCCCGCTGCGTTGCGCGCGTGTGCGCGTCTGCAACCCCATGAC
CCGGCCTTCACGTTTATGGATTACGAACAGGACTGGGACGGCGTTGCGATAACCCTGACG
TGGTCGCAGCTGTATCGGCGAACGCTGAATGTGGCACAGGAGCTGAGCCGTTGTGGTTCC
ACGGGTGACCGCGTGGTGATCTCTGCTCCGCAGGGACTCGAGTACGTCGTCGCCTTTCTC
GGCGCGTTGCAGGCCGGGCGCATCGCCGTGCCGCTTTCGGTTCCACAAGGCGGCGTTACC
GATGAACGTTCCGATTCGGTACTGAGTGATTCGTCGCCGGTGGCCATTCTCACTACATCG
TCTGCCGTGGACGACGTCGTGCAACATGTTGCGCGGCGGCCCGGGGAATCCCCGCCATCA
ATTATCGAAGTTGATTTGCTCGATCTGGACGCTCCGAATGGGTATACCTTCAAAGAAGAC
GAGTATCCATCTACCGCGTATTTGCAATACACCTCCGGGTCCACCCGCACGCCCGCTGGC
GTGGTGATGTCCCATCAGAACGTTCGGGTTAATTTCGAACAGCTGATGTCTGGCTACTTT
GCGGATACCGACGGGATTCCACCGCCAAATTCCGCACTCGTATCCTGGCTACCCTTCTAC
CACGACATGGGTTTGGTAATAGGAATTTGCGCACCAATTCTGGGTGGATACCCCGCGGTG
CTCACCAGCCCGGTGTCGTTCCTGCAGCGCCCGGCCCGGTGGATGCACTTGATGGCCAGC
GATTTTCACGCCTTTTCGGCAGCACCGAATTTCGCCTTTGAACTAGCGGCACGAAGAACA
ACCGACGACGACATGGCCGGGCGTGACCTCGGCAACATACTGACCATCCTCAGCGGTAGC
GAGCGGGTACAGGCCGCGACGATCAAGCGCTTCGCCGACCGCTTTGCTCGCTTCAATCTG
CAGGAGAGGGTGATCCGGCCTTCATACGGGCTCGCAGAAGCAACGGTGTACGTGGCGACG
AGCAAACCGGGTCAACCACCGGAGACCGTCGACTTCGATACTGAAAGTTTATCCGCCGGC
CATGCGAAGCCGTGCGCAGGCGGCGGCGCTACATCGTTGATCAGCTACATGTTGCCGCGG
TCACCGATCGTGCGGATCGTCGACTCGGACACCTGCATCGAATGTCCGGACGGAACCGTC
GGCGAGATCTGGGTGCACGGCGACAACGTCGCTAATGGCTATTGGCAAAAACCCGACGAG
AGTGAGCGCACGTTCGGCGGAAAGATTGTCACCCCTTCGCCGGGCACACCCGAAGGTCCT
TGGCTAAGAACGGGCGACTCAGGTTTCGTCACCGATGGCAAAATGTTCATCATCGGTCGG
ATCAAAGATCTCCTAATTGTGTACGGACGCAACCACTCCCCCGACGACATCGAGGCAACG
ATCCAGGAGATCACCCGCGGGCGCTGCGCGGCGATCTCGGTTCCCGGTGACCGCAGCACC
GAAAAGCTGGTCGCCATTATCGAACTCAAGAAGCGTGGCGACTCAGATCAGGACGCGATG
GCTAGACTGGGCGCTATTAAACGCGAAGTCACGTCGGCTTTATCGAGTTCGCACGGTCTC
AGCGTCGCGGATCTGGTTCTGGTTGCGCCTGGCTCGATCCCCATTACCACCAGCGGGAAG
GTCAGGAGAGGGGCGTGTGTCGAGCAATATCGACAGGATCAATTCGCCCGCTTGGATGCC
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPI	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPI	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. E. Pérez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPI	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISS	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISS	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. E. Pérez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Term	TBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISS	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Term	TBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPI	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
Term	TBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPI	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Term	TBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISS	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
Term	TBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISS	active	njamshidi	2012-10-05
	Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Interaction	PhysicalInteraction Rv2940c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Name	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic) OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic) AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,AM. Fitzmaurice,PE. Kolattukudy Open reading frame 3, which is adjacent to the mycocerosic acid synthase gene, is expressed as an acyl coenzyme A synthase in Mycobacterium bovis BCG. J. Bacteriol. 1997
Term	EC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002
Term	EC:6.2.1.- Ligases. Forming carbon-sulfur bonds. Acid--thiol ligases. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002