Rv2949c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2949c

Protein Domains

Gene Information
Locus	Rv2949c
Symbol
Gene Name	conserved hypothetical protein
Location	3299971 - 3300570 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:600 bp Protein:200 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	10680
Related Genes	ML0133 MT3022 MUL_2003
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2949c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2949c Transcript 1
MTECFLSDQEIRKLNRDLRILIAANGTLTRVLNIVADDEVIVQIVKQRIHDVSPKLSEFE
QLGQVGVGRVLQRYIILKGRNSEHLFVAAESLIAIDRLPAAIITRLTQTNDPLGEVMAAS
HIETFKEEAKVWVGDLPGWLALHGYQNSRKRAVARRYRVISGGQPIMVVTEHFLRSVFRD
APHEEPDRWQFSNAITLAR*

Genomic Sequence

>Rv2949c
ATGACCGAGTGTTTTCTATCTGATCAAGAGATCCGAAAGCTCAATCGTGACCTTCGAATA
CTGATAGCAGCTAATGGCACCCTCACTAGGGTTCTCAACATTGTCGCTGACGATGAGGTG
ATCGTGCAAATCGTCAAGCAGCGGATTCACGATGTTTCACCGAAGCTATCCGAATTCGAG
CAGCTAGGGCAGGTGGGGGTCGGCCGTGTTCTGCAGCGGTACATCATACTTAAAGGTCGG
AACTCGGAACACTTATTTGTAGCCGCGGAGTCGTTGATTGCGATTGATCGGTTGCCGGCT
GCAATTATAACAAGGTTGACGCAGACAAACGATCCTCTCGGCGAGGTTATGGCAGCCAGC
CACATCGAGACCTTCAAGGAAGAGGCTAAAGTCTGGGTCGGAGATTTGCCAGGTTGGCTC
GCGCTCCACGGGTATCAGAATTCCCGAAAGAGAGCCGTTGCCCGCCGTTATCGCGTTATT
TCCGGAGGCCAGCCGATCATGGTGGTGACGGAGCACTTTCTACGAAGCGTATTTCGAGAT
GCTCCGCATGAAGAACCTGATCGCTGGCAGTTTTCAAATGCCATCACTCTGGCGCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:CHRPL Chorismate pyruvate lyase - IDA	active	njamshidi	2012-10-05
	see PMID: 16210318 G. Stadthagen, J. Korduláková et al. p-Hydroxybenzoic acid synthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2005
Interaction	Operon Rv2950c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Regulatory Rv0348	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Operon Rv2950c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Operon Rv2949c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Operon Rv2949c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Operon Rv2948c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Name	p-hydroxybenzoic acid synthase	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Name	p-hydroxybenzoic acid synthase	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	p-hydroxybenzoic acid synthase (phenotypic [mycobacterial recombinant strains]; enzymatic) G. Stadthagen, J. Korduláková et al. p-Hydroxybenzoic acid synthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2005
Term	EC:4.-.-.- Lyases. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay G. Stadthagen, J. Korduláková et al. p-Hydroxybenzoic acid synthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2005