Rv3017c - Esat-6 like protein esxQ

Expression: Most Significant Conditions for Rv3017c

Protein Domains

Gene Information
Locus	Rv3017c
Symbol	esxQ
Gene Name	Esat-6 like protein esxQ
Location	3376490 - 3376852 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:363 bp Protein:121 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	14073
Related Genes	MT3097 MT3104 MUL_2243 Rv3019c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3017c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3017c Transcript 1
MSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQ
AMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSFRGRWLDPRHAGPATAADAGD
*

Genomic Sequence

>Rv3017c
GTGTCGCAGAGTATGTACAGCTACCCGGCGATGACGGCCAATGTCGGAGACATGGCCGGT
TATACGGGCACGACGCAGAGCTTGGGGGCCGATATCGCCAGTGAGCGCACCGCGCCGTCG
CGTGCTTGCCAAGGTGATCTCGGGATGAGTCATCAGGACTGGCAGGCCCAGTGGAATCAG
GCCATGGAGGCTCTCGCGCGGGCCTACCGTCGGTGCCGGCGAGCACTACGCCAGATCGGG
GTGCTGGAAAGGCCGGTAGGCGATTCGTCAGACTGCGGAACGATTAGGGTGGGGTCGTTC
CGGGGTCGGTGGCTGGACCCGCGCCATGCGGGTCCAGCCACGGCCGCCGACGCCGGAGAC
TAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) authors,L. Majlessi,MJ. Rojas,P. Brodin,C. Leclerc CD8+-T-cell responses of Mycobacterium-infected mice to a newly identified major histocompatibility complex class I-restricted epitope shared by proteins of the ESAT-6 family. Infect. Immun. 2003
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) A. Maciag, A. Piazza et al. Transcriptional analysis of ESAT-6 cluster 3 in Mycobacterium smegmatis. BMC Microbiol. 2009
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) RL. Skjøt, I. Brock et al. Epitope mapping of the immunodominant antigen TB10.4 and the two homologous proteins TB10.3 and TB12.9, which constitute a subfamily of the esat-6 gene family. Infect. Immun. 2002
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008