Rv3053c - glutaredoxin-like electron transport protein nrdH

Expression: Most Significant Conditions for Rv3053c

Protein Domains

Gene Information
Locus	Rv3053c
Symbol	nrdH
Gene Name	glutaredoxin-like electron transport protein nrdH
Location	3414719 - 3414958 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:240 bp Protein:80 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32450
Related Genes	BL0668 CE2425 cg2789 DIP1869 jk0476 MAP3102c MAV_3921 Mkms_1862 ML1736 Mmcs_1815 MSMEG_1017 MSMEG_2297 MT3139 MUL_1876 Mvan_2040 nfa43090
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3053c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3053c Transcript 1
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDH
WSGFRPDRIKALAGAALTA*

Genomic Sequence

>Rv3053c
ATGACCGTGACCGTTTACACTAAGCCCGCGTGCGTACAGTGCAGTGCCACCTCCAAGGCG
CTGGACAAGCAGGGCATCGCCTACCAGAAGGTTGATATCAGCCTGGATTCCGAAGCGCGG
GACTACGTGATGGCGCTGGGTTACCTACAAGCACCCGTCGTGGTCGCCGGAAACGACCAC
TGGTCGGGTTTCCGCCCCGATCGCATCAAGGCGCTCGCCGGGGCAGCGCTGACCGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv3052c	active	harsharohiratruefriend	2012-10-05
	co-transcription WU. Leiting,XI. Jianping Comparative genomics analysis of Mycobacterium NrdH-redoxins. Microb. Pathog. null
Interaction	Signaling Rv3051c	active	harsharohiratruefriend	2012-10-05
	co-transcription WU. Leiting,XI. Jianping Comparative genomics analysis of Mycobacterium NrdH-redoxins. Microb. Pathog. null
Interaction	Signaling Rv3052c	active	harsharohiratruefriend	2012-10-05
	co-transcription authors,M. Stehr,G. Schneider,F. Aslund,A. Holmgren,Y. Lindqvist Structural basis for the thioredoxin-like activity profile of the glutaredoxin-like NrdH-redoxin from Escherichia coli. J. Biol. Chem. 2001
Interaction	Signaling Rv3051c	active	harsharohiratruefriend	2012-10-05
	co-transcription authors,M. Stehr,G. Schneider,F. Aslund,A. Holmgren,Y. Lindqvist Structural basis for the thioredoxin-like activity profile of the glutaredoxin-like NrdH-redoxin from Escherichia coli. J. Biol. Chem. 2001
Interaction	Signaling Rv3052c	active	harsharohiratruefriend	2012-10-05
	co-transcription authors,E. Torrents,I. Roca,I. Gibert The open reading frame present in the nrdEF cluster of Corynebacterium ammoniagenes is a transcriptional regulator belonging to the GntR family. Curr. Microbiol. 2004
Interaction	Signaling Rv3051c	active	harsharohiratruefriend	2012-10-05
	co-transcription authors,E. Torrents,I. Roca,I. Gibert The open reading frame present in the nrdEF cluster of Corynebacterium ammoniagenes is a transcriptional regulator belonging to the GntR family. Curr. Microbiol. 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008