Rv3102c - cell division ATP-binding protein ftsE

Expression: Most Significant Conditions for Rv3102c

Protein Domains

Gene Information
Locus	Rv3102c
Symbol	ftsE
Gene Name	cell division ATP-binding protein ftsE
Location	3470680 - 3471369 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:690 bp Protein:230 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36007
Related Genes	Acel_1731 CE0812 cg0914 DIP0748 jk0456 MAP3172c MAV_4003 Mkms_1636 ML0669 Mmcs_1611 MSMEG_2089 MT3186 MUL_2409 Mvan_1914 nfa44850 PPA1353 SAV5104
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3102c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3102c Transcript 1
MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDV
RVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVP
EVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDL
LERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR*

Genomic Sequence

>Rv3102c
ATGATCACCCTGGACCATGTCACCAAGCAGTACAAATCGTCGGCGCGTCCGGCGTTGGAT
GACATCAACGTCAAGATCGACAAGGGTGAGTTCGTCTTCCTGATCGGCCCGTCGGGTTCG
GGCAAGTCAACCTTCATGCGGCTGCTGCTGGCAGCGGAGACGCCGACCAGTGGTGATGTC
CGGGTCTCGAAGTTTCATGTCAACAAACTCCGCGGTCGCCACGTACCGAAGCTGCGTCAG
GTGATCGGCTGCGTCTTCCAGGACTTTCGGTTGCTGCAGCAGAAGACGGTGTACGACAAC
GTCGCCTTCGCATTGGAGGTCATCGGCAAACGCACCGACGCGATCAACCGGGTGGTCCCC
GAAGTGCTCGAGACGGTCGGTCTGTCCGGCAAGGCCAATCGGCTGCCAGACGAGCTGTCG
GGCGGCGAGCAACAGCGCGTTGCGATCGCCCGCGCCTTTGTCAACCGGCCGCTGGTACTG
CTGGCCGACGAGCCCACCGGAAACCTCGACCCGGAGACCAGTAGGGACATCATGGACTTA
TTGGAGCGGATCAACCGCACCGGCACGACGGTGCTGATGGCCACGCACGACCACCACATC
GTCGACTCGATGCGCCAACGGGTGGTTGAGTTGTCCCTGGGCAGGCTGGTACGCGACGAA
CAGCGTGGCGTCTACGGGATGGATCGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2150c	active	ilamathi.raja	2012-10-05
	Affinity purification (Physical interaction) MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
Interaction	PhysicalInteraction Rv3101c	active	ilamathi.raja	2012-10-05
	Affinity purification (Physical interaction) MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
Interaction	PhysicalInteraction Rv3101c	active	ilamathi.raja	2012-10-05
	Affinity purification (Physical interaction) MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
Interaction	PhysicalInteraction Rv2150c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (physical interaction) P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv2150c	active	aparna.vchalam	2012-10-05
	Affinity purification (physical interaction) P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Name	Integral membrane protein component of an ABC transporter for a septation component	active	mjackson	2012-10-05
	Cell division
Name	Integral membrane protein component of an ABC transporter for a septation component	active	mjackson	2012-10-05
	Cell division
Name	Cell division protein,Z-ring complex Ia	active	rslayden	2012-03-05
	MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
Symbol	FtsE	active	rslayden	2012-03-05
	MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
Name	Cell division protein,Z-ring complex Ia	active	rslayden	2012-03-05
	authors,S. Roy,S. Vijay,M. Arumugam,D. Anand,M. Mir,P. Ajitkumar Mycobacterium tuberculosis expresses ftsE gene through multiple transcripts. Curr. Microbiol. 2011
Symbol	FtsE	active	rslayden	2012-03-05
	authors,S. Roy,S. Vijay,M. Arumugam,D. Anand,M. Mir,P. Ajitkumar Mycobacterium tuberculosis expresses ftsE gene through multiple transcripts. Curr. Microbiol. 2011