Rv3106 - NADPH:adrenodoxin oxidoreductase fprA

Expression: Most Significant Conditions for Rv3106

Protein Domains

Gene Information
Locus	Rv3106
Symbol	fprA
Gene Name	NADPH:adrenodoxin oxidoreductase fprA
Location	3474007 - 3475377 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1371 bp Protein:457 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34278
Related Genes	MAP3176 MAV_4007 Mkms_1632 ML0666 Mmcs_1607 MT3189 MUL_2413 Mvan_1910
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3106
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3106 Transcript 1
MRPYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKI
KSISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLP
GSIAAVDFVGWYNAHPHFEQVSPDLSGARAVVIGNGNVALDVARILLTDPDVLARTDIAD
HALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAELDGITDEDAAA
VGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGKRKVERIVLGRNELVSDGSG
RVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRINGSPNEYVVGWI
KRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKSFPEDHADQVADWLAARQPKLVTS
AHWQVIDAFERAAGEPHGRPRVKLASLAELLRIGLG*

Genomic Sequence

>Rv3106
ATGCGTCCCTATTACATCGCCATCGTGGGCTCCGGGCCGTCGGCGTTCTTCGCCGCGGCA
TCCTTGCTGAAGGCCGCCGACACGACCGAGGACCTCGACATGGCCGTCGACATGCTGGAG
ATGTTGCCGACTCCCTGGGGGCTGGTGCGCTCCGGGGTCGCGCCGGATCACCCCAAGATC
AAGTCGATCAGCAAGCAATTCGAAAAGACGGCCGAGGACCCCCGCTTCCGCTTCTTCGGC
AATGTGGTCGTCGGCGAACACGTCCAGCCCGGCGAGCTCTCCGAGCGCTACGACGCCGTG
ATCTACGCCGTCGGCGCGCAGTCCGATCGCATGTTGAACATCCCCGGTGAGGACCTGCCG
GGCAGTATCGCCGCCGTCGATTTCGTCGGCTGGTACAACGCACATCCACACTTCGAGCAG
GTATCACCCGATCTGTCGGGCGCCCGGGCCGTAGTTATCGGCAATGGAAACGTCGCGCTA
GACGTGGCACGGATTCTGCTCACCGATCCCGACGTGTTGGCACGCACCGATATCGCCGAT
CACGCTTTGGAATCGCTACGCCCACGCGGTATCCAGGAGGTGGTGATCGTCGGGCGCCGA
GGTCCGCTGCAGGCCGCGTTCACCACGTTGGAGTTGCGCGAGCTGGCCGACCTCGACGGG
GTTGACGTGGTGATCGATCCGGCGGAGCTGGACGGCATTACCGACGAGGACGCGGCCGCG
GTGGGCAAGGTCTGCAAGCAGAACATCAAGGTGCTGCGTGGCTATGCGGACCGCGAACCC
CGCCCGGGACACCGCCGCATGGTGTTCCGGTTCTTGACCTCTCCGATCGAGATCAAGGGC
AAGCGCAAAGTGGAGCGGATCGTGCTGGGCCGCAACGAGCTGGTCTCCGACGGCAGCGGG
CGAGTGGCGGCCAAGGACACCGGCGAGCGCGAGGAGCTGCCAGCTCAGCTGGTCGTGCGG
TCGGTCGGCTACCGCGGGGTGCCCACGCCCGGGCTGCCGTTCGACGACCAGAGCGGGACC
ATCCCCAACGTCGGCGGCCGAATCAACGGCAGCCCCAACGAATACGTCGTCGGGTGGATC
AAGCGCGGGCCGACCGGGGTGATCGGGACCAACAAGAAGGACGCCCAAGACACCGTCGAC
ACCTTGATCAAGAATCTTGGCAACGCCAAGGAGGGCGCCGAGTGCAAGAGCTTTCCGGAA
GATCATGCCGACCAGGTGGCCGACTGGCTAGCAGCACGCCAGCCGAAGCTGGTCACGTCG
GCCCACTGGCAGGTGATCGACGCTTTCGAGCGGGCCGCCGGCGAGCCGCACGGGCGTCCC
CGGGTCAAGTTGGCCAGCCTGGCCGAGCTGTTGCGGATTGGGCTCGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO3r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - ISS	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
Term	TBRXN:FRDO2r ferredoxin oxidoreductase - IDA	active	njamshidi	2012-10-05
	PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	EC:1.16.1.7 Ferric-chelate reductase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
Term	EC:1.18.1.2 Ferredoxin--NADP(+) reductase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002