Rv3126c - hypothetical protein

Expression: Most Significant Conditions for Rv3126c

Protein Domains

Gene Information
Locus	Rv3126c
Symbol
Gene Name	hypothetical protein
Location	3491808 - 3492122 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:315 bp Protein:105 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9226
Related Genes	MT3211
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3126c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3126c Transcript 1
MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER
DRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP*

Genomic Sequence

>Rv3126c
ATGGTCATCCGGTTTGATCAAATAGGGTCATTGGTCCTCTCAATGAAATCCCTTGCGTCA
CTGTCGTTTCAGCGGTGTCTGCGCGAGAATTCTAGTTTGGTCGCGGCGCTGGACCGGCTC
GATGCTGCGGTCGATGAGCTGAGCGCTTTGTCGTTTGATGCGTTGACCACTCCGGAGCGG
GATCGCGCCCGTCGCGACCGGGACCATCATCCTTGGTCCCGCTCCCGCTCGCAGTTGTCG
CCACGAATGGCGCACGGTGCAGTGCACCAATGCCAGTGGCCGAAGGCGGTTTGGGCTGTC
ATTGACAATCCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3127	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) authors,A. Zvi,N. Ariel,J. Fulkerson,JC. Sadoff,A. Shafferman Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. BMC medical genomics 2008
Interaction	Transcription Rv3127	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) Y. Hu, F. Movahedzadeh et al. Deletion of the Mycobacterium tuberculosis alpha-crystallin-like hspX gene causes increased bacterial growth in vivo. Infect. Immun. 2006
Interaction	Transcription Rv3127	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Transcription Rv3127	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) Y. Hu, F. Movahedzadeh et al. Deletion of the Mycobacterium tuberculosis alpha-crystallin-like hspX gene causes increased bacterial growth in vivo. Infect. Immun. 2006
Interaction	Transcription Rv3127	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003