Rv3127 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3127

Protein Domains

Gene Information
Locus	Rv3127
Symbol
Gene Name	conserved hypothetical protein
Location	3492147 - 3493181 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1035 bp Protein:345 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18951
Related Genes	MAP3273c MAV_4111 Mkms_2624 Mkms_4199 Mkms_4203 Mmcs_2579 Mmcs_4124 Mmcs_4128 MSMEG_5246 MT3212 MT3217 MUL_2417 MUL_2421 Mvan_0168 Mvan_2547 Mvan_2550 nfa27670 Rv3131
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3127
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3127 Transcript 1
MLKNAVLLACRAPSVHNSQPWRWVAESGSEHTTVHLFVNRHRTVPATDHSGRQAIISCGA
VLDHLRIAMTAAHWQANITRFPQPNQPDQLATVEFSPIDHVTAGQRNRAQAILQRRTDRL
PFDSPMYWHLFEPALRDAVDKDVAMLDVVSDDQRTRLVVASQLSEVLRRDDPYYHAELEW
WTSPFVLAHGVPPDTLASDAERLRVDLGRDFPVRSYQNRRAELADDRSKVLVLSTPSDTR
ADALRCGEVLSTILLECTMAGMATCTLTHLIESSDSRDIVRGLTRQRGEPQALIRVGIAP
PLAAVPAPTPRRPLDSVLQIRQTPEKGRNASDRNARETGWFSPP*

Genomic Sequence

>Rv3127
GTGCTCAAGAACGCAGTCTTGCTGGCATGCCGGGCGCCGTCGGTGCACAACAGCCAGCCC
TGGCGTTGGGTGGCCGAAAGCGGCTCCGAGCACACTACTGTGCACCTGTTCGTCAACCGC
CACCGAACGGTGCCGGCCACCGACCATTCCGGCCGGCAAGCGATCATCAGTTGCGGTGCC
GTACTCGATCACCTTCGCATCGCCATGACGGCCGCGCACTGGCAGGCGAATATCACTCGC
TTTCCCCAGCCGAACCAACCTGACCAGTTGGCCACCGTCGAATTCAGTCCCATCGATCAC
GTCACGGCGGGACAGCGAAACCGCGCCCAGGCGATTCTGCAGCGCCGAACCGATCGGCTT
CCGTTTGACAGCCCGATGTACTGGCACCTGTTTGAGCCCGCGCTGCGCGACGCCGTCGAC
AAAGACGTTGCGATGCTTGATGTGGTATCCGACGACCAGCGAACACGACTGGTGGTAGCG
TCACAACTCAGCGAAGTCCTGCGGCGGGACGATCCGTACTATCACGCCGAACTCGAATGG
TGGACTTCACCGTTCGTGCTGGCCCATGGTGTGCCGCCGGATACGCTGGCATCAGACGCC
GAACGCTTGCGGGTTGACCTGGGCCGTGACTTCCCGGTCCGGAGCTACCAGAATCGCCGT
GCCGAGCTAGCTGATGACCGATCGAAAGTCCTTGTGCTGTCGACCCCTAGCGACACGCGA
GCCGACGCACTGAGGTGTGGCGAAGTGCTGTCGACCATCCTACTCGAGTGCACCATGGCC
GGCATGGCTACCTGCACGTTGACCCATCTGATCGAATCCAGTGACAGTCGTGACATCGTG
CGGGGCCTGACGAGGCAGCGAGGCGAGCCGCAAGCCTTGATCCGGGTAGGGATAGCCCCG
CCGTTGGCAGCAGTTCCCGCCCCCACACCACGGCGGCCGCTGGACAGCGTCTTGCAGATT
CGCCAGACGCCCGAGAAAGGGCGTAATGCCTCAGATAGAAATGCCCGTGAAACGGGTTGG
TTCAGCCCGCCTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3126c	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) authors,A. Zvi,N. Ariel,J. Fulkerson,JC. Sadoff,A. Shafferman Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. BMC medical genomics 2008
Interaction	Transcription Rv3126c	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) Y. Hu, F. Movahedzadeh et al. Deletion of the Mycobacterium tuberculosis alpha-crystallin-like hspX gene causes increased bacterial growth in vivo. Infect. Immun. 2006
Interaction	Transcription Rv3126c	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Transcription Rv3126c	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) Y. Hu, F. Movahedzadeh et al. Deletion of the Mycobacterium tuberculosis alpha-crystallin-like hspX gene causes increased bacterial growth in vivo. Infect. Immun. 2006
Interaction	Transcription Rv3126c	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008