Rv3130c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3130c

Protein Domains

Gene Information
Locus	Rv3130c
Symbol
Gene Name	conserved hypothetical protein
Location	3494975 - 3496366 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1392 bp Protein:464 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21700
Related Genes	MT3216 MUL_2420
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3130c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3130c Transcript 1
MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLR
LRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWV
IEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGG
FRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLAD
VEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNR
VSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLL
MRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGIL
ADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV*

Genomic Sequence

>Rv3130c
ATGAATCACCTAACGACACTTGACGCCGGGTTTCTCAAGGCAGAAGACGTGGATCGGCAC
GTGAGTCTGGCAATCGGCGCTCTGGCGGTCATCGAGGGGCCGGCTCCCGATCAGGAAGCC
TTCTTATCGTCGCTCGCTCAACGCCTACGTCCCTGTACCCGGTTCGGGCAGCGGTTACGC
CTGCGCCCGTTCGACCTCGGTGCACCCAAATGGGTGGACGATCCCGACTTCGATCTTGGC
CGTCATGTGTGGCGCATCGCCTTGCCGCGGCCTGGCAACGAAGACCAGTTATTCGAGCTG
ATCGCCGATCTGATGGCGCGTCGTTTGGACCGGGGTCGACCGCTGTGGGAGGTCTGGGTC
ATCGAAGGCCTGGCGGACAGCAAGTGGGCGATCCTGACCAAACTGCACCACTGCATGGCC
GACGGAATCGCGGCGACTCACCTGCTAGCTGGGCTCTCCGATGAAAGTATGAGCGACAGC
TTCGCGAGCAACATCCACACGACCATGCAGTCGCAATCCGCATCTGTGCGGCGGGGTGGA
TTCCGTGTCAATCCAAGCGAGGCGTTGACCGCGTCGACCGCCGTGATGGCAGGCATCGTT
CGCGCGGCCAAGGGTGCCAGTGAGATCGCGGCCGGCGTGCTAAGTCCCGCCGCGTCGTCG
TTGAACGGGCCGATCAGTGATTTGCGTCGCTACAGCGCAGCAAAGGTCCCTCTCGCCGAC
GTCGAACAGGTGTGCCGGAAATTCGACGTCACCATCAATGATGTTGCGCTTGCCGCGATT
ACGGAAAGCTACCGCAACGTCCTCATCCAGCGGGGTGAGCGGCCTAGGTTTGATTCGCTG
CGTACGCTAGTGCCGGTCTCGACGCGTTCCAACAGCGCTTTGAGCAAGACCGATAACCGT
GTTTCGTTAATGCTGCCCAACCTGCCGGTGGATCAAGAGAACCCGCTGCAGCGGCTGCGG
ATCGTGCACTCGCGGCTGACTCGGGCCAAGGCGGGGGGACAGAGACAATTCGGAAATACT
TTGATGGCGATTGCCAACCGCCTTCCGTTCCCCATGACCGCATGGGCGGTCGGGCTGTTG
ATGCGGCTGCCGCAGCGTGGTGTTGTCACCGTGGCGACAAATGTGCCGGGTCCACGACGG
CCGCTGCAGATTATGGGCAGACGGGTGCTTGACCTATACCCGGTTTCGCCGATCGCGATG
CAACTGCGCACCAGTGTCGCGATGCTCAGCTACGCCGACGACCTGTACTTCGGGATCCTG
GCCGACTACGACGTGGTAGCAGATGCCGGCCAGCTGGCGCGAGGAATTGAAGACGCCGTC
GCACGGCTGGTGGCGATCAGTAAGCGGCGCAAGGTGACTCGCAGGCGCGGAGCGCTATCG
CTGGTTGTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3133c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv0348	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Name	acyl CoA:diacylglycerol acyltransferase	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Symbol	tgs1	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Name	acyl CoA:diacylglycerol acyltransferase	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Symbol	tgs1	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Term	EC:2.3.1.20 Diacylglycerol O-acyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006
Other	TBPWY:Triglyceride biosynthesis	active	mjackson	2012-03-05
	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Symbol	tgs1	active	mjackson	2012-03-05
	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Other	TBPWY:Triglyceride biosynthesis	active	mjackson	2012-03-05
	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006
Symbol	tgs1	active	mjackson	2012-03-05
	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006