Rv3133c - two component system transcriptional regulator devR

Expression: Most Significant Conditions for Rv3133c

Protein Domains

Gene Information
Locus	Rv3133c
Symbol	devR
Gene Name	two component system transcriptional regulator devR
Location	3499262 - 3499915 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:654 bp Protein:218 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36035
Related Genes	MAP3271c MAV_4109 Mkms_4201 Mmcs_4126 MSMEG_5244 MT3219 MUL_2423 Mvan_2548 nfa19100
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3133c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3133c Transcript 1
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDG
NGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGA
GRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKT
VKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP*

Genomic Sequence

>Rv3133c
GTGGTAAAGGTCTTCTTGGTCGATGACCACGAGGTGGTGCGTCGTGGTCTGGTTGACTTG
CTTGGGGCCGATCCCGAGCTTGACGTCGTAGGTGAGGCGGGTTCGGTCGCCGAGGCGATG
GCCAGGGTTCCTGCCGCGCGCCCAGATGTCGCGGTGCTGGATGTCCGGTTGCCCGATGGC
AACGGCATTGAACTGTGCCGCGATCTGTTGTCCCGCATGCCCGATCTGCGCTGTCTGATC
CTCACGTCCTACACCTCTGACGAGGCCATGCTAGATGCGATTCTCGCCGGTGCCAGCGGA
TATGTCGTCAAAGACATCAAGGGAATGGAGTTGGCGCGCGCCGTCAAAGATGTGGGCGCT
GGACGGTCGCTGCTGGACAATCGGGCCGCGGCCGCGCTGATGGCCAAGCTGCGCGGTGCC
GCCGAGAAGCAGGACCCGCTATCAGGCCTTACCGACCAGGAGCGGACGCTACTGGGCCTG
CTTAGCGAGGGCCTGACCAACAAGCAGATCGCCGACCGAATGTTCCTAGCCGAAAAGACG
GTGAAGAACTACGTGTCGCGGTTGCTGGCCAAGCTGGGCATGGAACGTCGGACGCAAGCC
GCGGTATTCGCGACGGAGTTGAAGCGCTCGCGGCCACCCGGTGATGGACCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3690	active	aparna.vchalam	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv3690	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv3505	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3504	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3143	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under "in vitro" stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3131	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv3130c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv3129	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Interaction	Regulatory Rv3129	active	kaveri.verma	2012-10-05
	Co-expression (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv2627c	active	shruti4rana	2012-10-05
	MY. Lin,TB. Reddy,SM. Arend,AH. Friggen,KL. Franken,KE. van Meijgaarden,MJ. Verduyn,GK. Schoolnik,MR. Klein,TH. Ottenhoff Cross-reactive immunity to Mycobacterium tuberculosis DosR regulon-encoded antigens in individuals infected with environmental, nontuberculous mycobacteria. Infect. Immun. 2009
Interaction	Regulatory Rv2625c	active	shruti4rana	2012-10-05
	GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Interaction	Transcription Rv2623	active	sourish10	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Transcription Rv2623	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,M. Seki,I. Honda,I. Fujita,I. Yano,S. Yamamoto,A. Koyama Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guérin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains. Vaccine 2009
Interaction	Transcription Rv2623	active	sourish10	2012-10-05
	Co-expression (Functional linkage) JE. Drumm, K. Mi et al. Mycobacterium tuberculosis universal stress protein Rv2623 regulates bacillary growth by ATP-Binding: requirement for establishing chronic persistent infection. PLoS Pathog. 2009
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2487c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv2408	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv2255c	active	akankshajain.21	2012-10-05
	Co-expression (Functional Linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Signaling Rv2031c	active	priti.priety	2012-10-05
	affinity purification A. Demissie, EM. Leyten et al. Recognition of stage-specific mycobacterial antigens differentiates between acute and latent infections with Mycobacterium tuberculosis. Clin. Vaccine Immunol. 2006
Interaction	Signaling Rv2031c	active	priti.priety	2012-10-05
	affinity purification M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) J. Starck, G. Källenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	ActivatedBy Rv2027c	active	priti.priety	2012-10-05
	Band Shift DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	ActivatedBy Rv2027c	active	priti.priety	2012-10-05
	Band Shift DK. Saini, V. Malhotra et al. Cross talk between DevS sensor kinase homologue, Rv2027c, and DevR response regulator of Mycobacterium tuberculosis. FEBS Lett. 2004
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) J. Starck, G. Källenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	Inhibits Rv2021c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv2007c	active	prabhakarsmail	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2007c	active	akankshajain.21	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2003c	active	shahanup86	2012-10-05
	coexpression(Functional Linkage) authors,J. Bacon,BW. James,L. Wernisch,A. Williams,KA. Morley,GJ. Hatch,JA. Mangan,J. Hinds,NG. Stoker,PD. Butcher,PD. Marsh The influence of reduced oxygen availability on pathogenicity and gene expression in Mycobacterium tuberculosis. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	authors,H. Ohno,G. Zhu,VP. Mohan,D. Chu,S. Kohno,WR. Jacobs,J. Chan The effects of reactive nitrogen intermediates on gene expression in Mycobacterium tuberculosis. Cell. Microbiol. 2003
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	D. Agranoff & S. Krishna Metal ion transport and regulation in Mycobacterium tuberculosis. Front. Biosci. 2004
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv1996	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010
Interaction	Regulatory Rv1996	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv1706c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	Regulatory Rv1706c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PH. Chow,DK. Chan The cardiac cycle and the effects of neurohumors on myocardial contractility in the Asiatic eel Anguilla japonica, Timm. & Schle. Comp. Biochem. Physiol. C, Comp. Pharmacol. 1975
Interaction	Regulatory Rv1706c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PB. Disler,SR. Lynch,JD. Torrance,MH. Sayers,TH. Bothwell,RW. Charlton The mechanism of the inhibition of iron absorption by tea. S Afr J Med Sci 1975
Interaction	Regulatory Rv1706c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0830	active	bhupender.srcp	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0830	active	bhupender.srcp	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0796	active	kandarpbioinfo	2012-10-05
	Coexpression SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0570	active	sourish10	2012-10-05
	PCR authors,J. Nurbo,AK. Roos,D. Muthas,E. Wahlström,DJ. Ericsson,T. Lundstedt,T. Unge,A. Karlén Design, synthesis and evaluation of peptide inhibitors of Mycobacterium tuberculosis ribonucleotide reductase. J. Pept. Sci. 2007
Interaction	Regulatory Rv0570	active	sourish10	2012-10-05
	PCR SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003
Interaction	Regulatory Rv0570	active	ahal4789	2012-10-05
	PCR authors,J. Nurbo,AK. Roos,D. Muthas,E. Wahlström,DJ. Ericsson,T. Lundstedt,T. Unge,A. Karlén Design, synthesis and evaluation of peptide inhibitors of Mycobacterium tuberculosis ribonucleotide reductase. J. Pept. Sci. 2007
Interaction	Regulatory Rv0570	active	ahal4789	2012-10-05
	PCR SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003
Interaction	Regulatory Rv0256c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0081	active	harsharohiratruefriend	2012-10-05
	GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Interaction	Regulatory Rv0080	active	shahanup86	2012-10-05
	Co-expression (Functional linkage)
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3833	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3505	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3504	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3134c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3132c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2590	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0468	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0467	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0353	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0352	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0351	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0350	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2669	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulates Rv2006	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3134c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3131	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3130c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3127	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2628	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2627c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2626c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2032	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2007c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2006	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2005c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1996	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1813c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1738	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1737c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1734c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1733c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0574c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0571c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0079	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3128c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3126c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3841	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3132c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3129	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2830c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2631	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2630	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2629	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2625c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2624c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2623	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2030c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2029c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2028c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2004c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2003c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv1997	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv1812c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv1736c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0572c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0570	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0569	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0083	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0082	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0081	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0080	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0079	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Gene Ontology Term	dormancy process - IC	active	bweiner	2011-01-03