Rv3151 - NADH dehydrogenase I chain G nuoG

Expression: Most Significant Conditions for Rv3151

Protein Domains

Gene Information
Locus	Rv3151
Symbol	nuoG
Gene Name	NADH dehydrogenase I chain G nuoG
Location	3516746 - 3519166 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2421 bp Protein:807 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28565
Related Genes	Acel_0273 MAP3207 MAV_4039 Mkms_1598 Mmcs_1574 MSMEG_2057 MT3239 MUL_2465 Mvan_1879 nfa26610 PPA1930 SAV4843
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3151
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3151 Transcript 1
MTQAADTDIRVGQPEMVTLTIDGVEISVPKGTLVIRAAELMGIQIPRFCDHPLLEPVGAC
RQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQHGVMELLLINHPLDCPMCDK
GGECPLQNQAMSNGRTDSRFTEAKRTFAKPINISAQVLLDRERCILCARCTRFSDQIAGD
PFIDMQERGALQQVGIYADEPFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVC
EHCASGCAQRTDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAAQGLAAARGRTGVLVGGRVTWEDAYAYAKFARITLGTNDIDF
RARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGFEPEDESPIVFLRLRKAARRH
RVPVYTIAPFATGGLHKMSGRLIKTVPGGEPAALDDLATGAVGDLLATPGAVIIVGERLA
TVPGGLSAAARLADTTGARLAWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAA
WHIAELPAAAGRDADGILAAAADETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSTVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSTLQAGQSDHRVLDALADD
MGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQPEAGEAILTGWRMLLDEGRL
QDGEPYLAGTARTPVVRLSPDTAAEIGAADGEAVTVSTSRGSITLPCSVTDMPDRVVWLP
LNSAGSTVHRQLRVTIGSIVKIGAGS*

Genomic Sequence

>Rv3151
GTGACCCAGGCGGCCGACACTGACATCCGGGTAGGCCAACCGGAGATGGTGACACTGACC
ATCGACGGCGTCGAAATCAGCGTCCCCAAGGGCACGTTGGTGATTCGCGCCGCCGAACTG
ATGGGAATCCAGATCCCGCGATTCTGCGACCACCCGCTGCTGGAGCCCGTCGGCGCCTGC
CGGCAATGCCTGGTCGAGGTCGAAGGGCAACGCAAGCCGCTGGCGTCGTGCACCACCGTG
GCCACCGACGACATGGTGGTGCGCACCCAACTCACCTCCGAGATTGCCGACAAGGCCCAG
CACGGTGTGATGGAACTGCTGCTGATCAACCATCCGCTGGATTGCCCGATGTGCGACAAG
GGCGGTGAATGCCCGCTGCAAAACCAGGCAATGTCTAACGGCCGCACGGATTCTCGCTTC
ACCGAGGCCAAACGTACCTTCGCCAAACCGATCAACATCTCCGCGCAGGTGCTGCTGGAC
CGCGAACGTTGCATCCTGTGCGCCCGCTGCACCCGGTTCTCCGACCAGATCGCCGGCGAT
CCGTTCATCGATATGCAGGAGCGCGGCGCCCTGCAGCAGGTCGGTATCTACGCCGATGAA
CCGTTCGAGTCGTACTTCTCCGGCAACACGGTGCAGATCTGCCCGGTGGGGGCGCTAACG
GGGACCGCCTACCGGTTCCGCGCGCGTCCGTTCGATTTGGTCTCCAGCCCCAGCGTCTGC
GAGCACTGCGCGTCGGGCTGCGCGCAACGCACCGACCATCGCCGCGGCAAGGTGCTGCGG
CGGCTGGCCGGTGACGACCCGGAAGTCAACGAGGAGTGGAACTGCGACAAGGGCCGGTGG
GCCTTCACGTACGCGACCCAGCCGGACGTGATCACCACTCCCCTGATCCGCGACGGTGGG
GACCCCAAGGGCGCGCTGGTGCCCACCTCGTGGTCGCACGCAATGGCGGTGGCCGCCCAG
GGACTGGCGGCAGCGCGGGGCCGCACCGGGGTGCTGGTCGGCGGCCGAGTGACCTGGGAG
GACGCCTACGCGTACGCCAAGTTCGCGCGGATCACGTTGGGCACCAACGACATCGACTTC
CGCGCCCGGCCGCACTCGGCCGAGGAGGCCGACTTCCTGGCGGCCCGCATCGCCGGGCGG
CATATGGCGGTCAGCTATGCCGATTTGGAATCGGCTCCGGTGGTGCTGCTGGTGGGATTC
GAGCCCGAAGACGAGTCGCCGATCGTGTTTCTGCGGTTACGCAAGGCCGCTCGCAGACAC
CGCGTCCCGGTGTACACGATCGCCCCCTTTGCCACTGGTGGCCTGCACAAAATGTCGGGC
CGGCTGATCAAAACCGTTCCTGGTGGCGAACCCGCGGCGCTGGACGATCTGGCCACCGGT
GCAGTGGGCGACCTGCTGGCCACCCCGGGCGCGGTCATCATAGTCGGGGAGCGCTTGGCC
ACGGTACCGGGCGGATTGTCGGCGGCCGCTCGGCTGGCCGATACGACCGGCGCCCGTTTG
GCGTGGGTGCCGCGGCGGGCGGGGGAACGCGGAGCGCTGGAAGCCGGAGCGTTGCCCACG
CTGTTACCCGGTGGCCGCCCGCTGGCCGACGAGGTCGCCCGCGCGCAGGTGTGTGCGGCG
TGGCATATCGCCGAATTGCCTGCCGCGGCTGGACGGGACGCCGACGGCATCCTGGCCGCC
GCTGCCGACGAGACGTTGGCTGCGCTGCTGGTCGGGGGTATCGAACCCGCGGACTTCGCC
GACCCGGACGCCGTGCTGGCCGCGTTGGACGCCACCGGTTTCGTGGTCAGCCTGGAGCTG
CGACACAGTACGGTCACCGAACGCGCCGACGTGGTGTTCCCGGTCGCGCCGACGACCCAG
AAAGCCGGCGCGTTCGTCAACTGGGAGGGTCGCTACCGTACATTCGAACCCGCGCTGCGC
GGCAGCACACTGCAAGCTGGCCAGTCGGATCACCGGGTGCTGGACGCGTTGGCCGACGAC
ATGGGTGTCCATCTGGGCGTGCCCACCGTGGAGGCGGCCCGCGAGGAGCTGGCCGCGCTC
GGTATCTGGGACGGCAAACACGCTGCCGGTCCCCACATCGCGGCCACCGGGCCGACCCAA
CCCGAAGCTGGTGAGGCGATCTTGACCGGGTGGCGGATGCTCCTCGACGAGGGCCGCCTG
CAGGACGGCGAACCATATCTGGCCGGTACCGCGCGCACACCCGTGGTACGGCTGTCGCCG
GATACGGCAGCCGAGATCGGCGCCGCCGATGGCGAGGCGGTCACGGTCAGCACGTCACGC
GGCTCAATCACCTTGCCGTGCAGTGTCACCGACATGCCCGACCGCGTCGTGTGGCTTCCG
CTGAACTCGGCGGGCTCGACGGTGCACCGACAGCTGAGGGTGACAATCGGCAGCATCGTG
AAAATCGGAGCGGGCTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) JL. Miller,K. Velmurugan,MJ. Cowan,V. Briken The type I NADH dehydrogenase of Mycobacterium tuberculosis counters phagosomal NOX2 activity to inhibit TNF-alpha-mediated host cell apoptosis. PLoS Pathog. 2010
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) K. Velmurugan, B. Chen et al. Mycobacterium tuberculosis nuoG is a virulence gene that inhibits apoptosis of infected host cells. PLoS Pathog. 2007
Interaction	Signaling Rv0757	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008