Rv3155 - NADH dehydrogenase I chain K nuoK

Expression: Most Significant Conditions for Rv3155

Protein Domains

Gene Information
Locus	Rv3155
Symbol	nuoK
Gene Name	NADH dehydrogenase I chain K nuoK
Location	3521924 - 3522223 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:300 bp Protein:100 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28467
Related Genes	Acel_0277 MAP3211 MAV_4043 Mkms_1594 Mmcs_1570 MSMEG_2053 MT3243 MUL_2469 Mvan_1875 nfa26580 PPA1925 SAV4847
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3155
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3155 Transcript 1
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMI
AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG*

Genomic Sequence

>Rv3155
ATGAATCCGGCCAACTACCTTTATCTTTCGGTGCTGCTATTCACCATCGGAGCCTCCGGT
GTGCTGCTGCGACGCAACGCGATCGTGATGTTCATGTGCGTCGAGCTCATGCTCAATGCC
GTTAACCTGGCGTTCGTCACCTTCGCGCGCATGCATGGCCATCTCGACGCCCAGATGATC
GCGTTCTTCACCATGGTGGTGGCCGCCTGCGAAGTGGTCGTCGGCCTGGCCATCATCATG
ACGATTTTCCGTACCCGCAAATCGGCGTCGGTCGACGACGCGAATCTACTCAAAGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976