Rv3334 - transcriptional regulator, merR-family

Expression: Most Significant Conditions for Rv3334

Protein Domains

Gene Information
Locus	Rv3334
Symbol
Gene Name	transcriptional regulator, merR-family
Location	3721257 - 3721697 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:441 bp Protein:147 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	24958
Related Genes	MAP1259 MAV_3222 MSMEG_3180 MT3438 nfa30970
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3334
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3334 Transcript 1
MKISEVAALTNTSTKTLRFYENSGLLPPPARTASGYRNYGPEIVDRLRFIHRGQAAGLAL
QEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIALEGHLQTLLDHASYGPPTEH
DHSTVCWILESDLDEPTAIEVSDIHA*

Genomic Sequence

>Rv3334
ATGAAGATCAGCGAGGTAGCCGCGCTCACCAACACCAGCACCAAGACCCTCCGCTTCTAC
GAGAACTCGGGGCTGCTGCCGCCGCCTGCACGCACAGCATCGGGGTATCGCAACTATGGA
CCCGAGATCGTGGATCGGCTGCGGTTTATCCATCGGGGCCAAGCGGCCGGGCTGGCATTA
CAGGAAGTACGCCAAATCCTGGCCATCCACGACCGCGGCGAGGCGCCGTGCGCACACGTC
CGCCAACTACTGAGCACCCGCATCGACGAAGTCCGCGCGCAGATCGCCGAACTGATTGCC
CTCGAAGGCCACTTGCAGACCCTGCTTGACCACGCTTCATATGGCCCGCCCACCGAACAC
GACCACTCCACGGTGTGTTGGATCCTGGAAAGCGACCTCGATGAGCCCACCGCCATCGAG
GTCAGCGACATTCACGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1674c	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) Y. Kong, MD. Cave et al. Population-based study of deletions in five different genomic regions of Mycobacterium tuberculosis and possible clinical relevance of the deletions. J. Clin. Microbiol. 2006
Interaction	Transcription Rv1674c	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv3552	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3551	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3550	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0969	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0969	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006