Rv3357 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3357

Protein Domains

Gene Information
Locus	Rv3357
Symbol
Gene Name	conserved hypothetical protein
Location	3770773 - 3771048 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:276 bp Protein:92 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2254
Related Genes	jk0893 MT3465 SAV3206
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3357
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3357 Transcript 1
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENAR
RLMEAVARDKAGHSAFTKSVDELREMAGGEE*

Genomic Sequence

>Rv3357
ATGAGCATCAGTGCGAGCGAGGCGAGGCAGCGCCTGTTTCCACTCATCGAACAGGTCAAT
ACCGATCACCAGCCGGTGCGGATCACCTCCCGGGCCGGCGATGCGGTGCTGATGTCCGCC
GACGACTACGACGCGTGGCAGGAAACGGTCTATCTGCTGCGCTCACCGGAGAACGCCAGG
CGGTTGATGGAAGCGGTTGCCCGGGATAAGGCTGGGCACTCGGCTTTCACCAAGTCTGTA
GATGAGCTGCGGGAGATGGCCGGCGGCGAGGAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3358	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3358	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Symbol	relJ	active	jlew	2012-03-07
	Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
Symbol	relB3	active	jlew	2012-03-07
	Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin. authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Symbol	relJ	active	jlew	2012-03-07
	Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Symbol	RelB3	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	yefM	active	jlew	2012-03-07
	Structure authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Other	strand:+	active	rslayden	2012-03-05
	MTV006.19c (89 aa) (36.9% identity in 84 aa overlap). SEEMS TO BELONG TO THE PHD/YEFM FAMILY.
Other	stop:3771048	active	rslayden	2012-03-05
	MTV006.19c (89 aa) (36.9% identity in 84 aa overlap). SEEMS TO BELONG TO THE PHD/YEFM FAMILY.
Other	start:3770773	active	rslayden	2012-03-05
	MTV006.19c (89 aa) (36.9% identity in 84 aa overlap). SEEMS TO BELONG TO THE PHD/YEFM FAMILY.
Symbol	rel BE-3	active	rslayden	2012-03-05
	MTV006.19c (89 aa) (36.9% identity in 84 aa overlap). SEEMS TO BELONG TO THE PHD/YEFM FAMILY.
Other	strand:+	active	rslayden	2012-03-05
	SAV2408 from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 161, E(): 8.8e-05, (39.95% identity in 77 aa overlap); Q9Z5W8 PUTATIVE PHD PROTEIN from Francisella novicid (85 aa), FASTA scores: opt: 143, E(): 0.0016, (28.9% identity in 83 aa overlap); etc. Also similar to Rv1247c
Other	stop:3771048	active	rslayden	2012-03-05
	SAV2408 from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 161, E(): 8.8e-05, (39.95% identity in 77 aa overlap); Q9Z5W8 PUTATIVE PHD PROTEIN from Francisella novicid (85 aa), FASTA scores: opt: 143, E(): 0.0016, (28.9% identity in 83 aa overlap); etc. Also similar to Rv1247c
Other	start:3770773	active	rslayden	2012-03-05
	SAV2408 from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 161, E(): 8.8e-05, (39.95% identity in 77 aa overlap); Q9Z5W8 PUTATIVE PHD PROTEIN from Francisella novicid (85 aa), FASTA scores: opt: 143, E(): 0.0016, (28.9% identity in 83 aa overlap); etc. Also similar to Rv1247c
Symbol	rel BE-3	active	rslayden	2012-03-05
	SAV2408 from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 161, E(): 8.8e-05, (39.95% identity in 77 aa overlap); Q9Z5W8 PUTATIVE PHD PROTEIN from Francisella novicid (85 aa), FASTA scores: opt: 143, E(): 0.0016, (28.9% identity in 83 aa overlap); etc. Also similar to Rv1247c
Other	strand:+	active	rslayden	2012-03-05
	B2017 from Escherichia coli strain K12 (83 aa), FASTA scores: opt: 215, E(): 1.6e-08, (50.0% identity in 72 aa overlap); BAB58570
Other	stop:3771048	active	rslayden	2012-03-05
	B2017 from Escherichia coli strain K12 (83 aa), FASTA scores: opt: 215, E(): 1.6e-08, (50.0% identity in 72 aa overlap); BAB58570
Other	start:3770773	active	rslayden	2012-03-05
	B2017 from Escherichia coli strain K12 (83 aa), FASTA scores: opt: 215, E(): 1.6e-08, (50.0% identity in 72 aa overlap); BAB58570
Symbol	rel BE-3	active	rslayden	2012-03-05
	B2017 from Escherichia coli strain K12 (83 aa), FASTA scores: opt: 215, E(): 1.6e-08, (50.0% identity in 72 aa overlap); BAB58570
Other	strand:+	active	rslayden	2012-03-05
	YEFM_ECOLI
Other	stop:3771048	active	rslayden	2012-03-05
	YEFM_ECOLI
Other	start:3770773	active	rslayden	2012-03-05
	YEFM_ECOLI
Symbol	rel BE-3	active	rslayden	2012-03-05
	YEFM_ECOLI
Other	strand:+	active	rslayden	2012-03-05
	SCBAC17D6.02) ORFU1E (BELONGS TO THE PHD/YEFM FAMILY) from Streptomyces coelicolor (87 aa), FASTA scores: opt: 344, E(): 1.9e-17, (62.05% identity in 87 aa overlap); P46147
Other	stop:3771048	active	rslayden	2012-03-05
	SCBAC17D6.02) ORFU1E (BELONGS TO THE PHD/YEFM FAMILY) from Streptomyces coelicolor (87 aa), FASTA scores: opt: 344, E(): 1.9e-17, (62.05% identity in 87 aa overlap); P46147
Other	start:3770773	active	rslayden	2012-03-05
	SCBAC17D6.02) ORFU1E (BELONGS TO THE PHD/YEFM FAMILY) from Streptomyces coelicolor (87 aa), FASTA scores: opt: 344, E(): 1.9e-17, (62.05% identity in 87 aa overlap); P46147
Symbol	rel BE-3	active	rslayden	2012-03-05
	SCBAC17D6.02) ORFU1E (BELONGS TO THE PHD/YEFM FAMILY) from Streptomyces coelicolor (87 aa), FASTA scores: opt: 344, E(): 1.9e-17, (62.05% identity in 87 aa overlap); P46147
Other	strand:+	active	rslayden	2012-03-05
	YU1E_STRCO (alias CAC37261
Other	stop:3771048	active	rslayden	2012-03-05
	YU1E_STRCO (alias CAC37261
Other	start:3770773	active	rslayden	2012-03-05
	YU1E_STRCO (alias CAC37261
Symbol	rel BE-3	active	rslayden	2012-03-05
	YU1E_STRCO (alias CAC37261
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9Z4V7
Other	stop:3771048	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9Z4V7
Other	start:3770773	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9Z4V7
Symbol	rel BE-3	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9Z4V7