Rv3462c - translation initiation factor IF-1 infA

Expression: Most Significant Conditions for Rv3462c

Protein Domains

Gene Information
Locus	Rv3462c
Symbol	infA
Gene Name	translation initiation factor IF-1 infA
Location	3880432 - 3880653 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:222 bp Protein:74 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18522
Related Genes	Acel_0329 BL1602 CE0568 cg0651 DIP0545 jk1762 MAP4228 MAV_4403 Mkms_1125 ML1962 Mmcs_1108 MSMEG_1519 MT3568 MUL_0843 Mvan_1431 nfa8320 PPA1832 SAV4949 SAV504
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3462c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3462c Transcript 1
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSP
YDLSRGRIVYRYK*

Genomic Sequence

>Rv3462c
ATGGCCAAGAAGGACGGTGCCATAGAGGTCGAGGGTCGCGTGGTCGAGCCCCTGCCCAAT
GCCATGTTCCGCATTGAGCTGGAGAACGGCCACAAGGTGCTCGCCCACATCAGCGGCAAG
ATGCGTCAGCACTACATTCGCATCCTGCCCGAGGACCGGGTGGTGGTGGAATTGTCGCCC
TACGACCTGTCCCGGGGCCGCATCGTGTACCGGTACAAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv2069	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008