Rv3542c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3542c

Protein Domains

Gene Information
Locus	Rv3542c
Symbol
Gene Name	conserved hypothetical protein
Location	3981045 - 3981980 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:936 bp Protein:312 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19786
Related Genes	MAP0525 MAV_0619 Mkms_4760 Mmcs_4674 MSMEG_5992 MT3646 MUL_4103 Mvan_5255 nfa4510
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3542c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3542c Transcript 1
MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVDDAAARAAGHP
GIVAPPAMIQVWTMMGLGGVRPKDDPLGPIIKLFDDAGYIGVVATNCEQTYHRYLLPGEQ
VSISAELGDVVGPKQTALGEGWFINQHIVWQVGDEDVAEMNWRILKFKPAGSPSSVPDDL
DPDAMMRPSSSRDTAFFWDGVKAHELRIQRLADGSLRHPPVPAVWQDKSVPINYVVSSGR
GTVFSFVVHHAPKVPGRTVPFVIALVELEEGVRMLGELRGADPARVAIGMPVRATYIDFP
DWSLYAWEPDE*

Genomic Sequence

>Rv3542c
GTGACCGGGGTGAGCGACATTCAGGAAGCGGTTGCCCAGATCAAGGCGGCCGGGCCCAGC
AAGCCGCGCCTGGCCCGTGACCCGGTGAACCAGCCGATGATCAACAACTGGGTGGAGGCC
ATCGGCGACCGCAACCCCATCTATGTGGACGACGCGGCGGCTCGCGCCGCCGGCCACCCC
GGAATCGTCGCGCCACCGGCCATGATTCAGGTGTGGACCATGATGGGTCTGGGCGGAGTG
CGTCCGAAGGACGATCCGCTGGGACCCATCATCAAGCTGTTCGACGACGCCGGCTACATC
GGTGTGGTTGCCACCAACTGCGAGCAGACCTACCACCGCTACCTATTGCCCGGGGAGCAA
GTCAGCATCAGCGCCGAGCTCGGTGACGTCGTCGGACCCAAGCAAACCGCGCTCGGCGAG
GGCTGGTTCATCAACCAGCACATCGTATGGCAAGTCGGGGACGAGGACGTCGCAGAGATG
AATTGGCGCATCCTCAAATTCAAGCCCGCGGGTTCTCCGAGCTCGGTGCCTGACGATTTG
GATCCCGACGCTATGATGCGTCCCTCGTCGTCGCGGGACACCGCGTTTTTCTGGGATGGA
GTCAAGGCCCACGAATTGCGGATCCAGCGGCTTGCCGATGGCAGCCTGCGGCACCCACCG
GTGCCGGCGGTGTGGCAAGACAAATCGGTGCCGATCAACTACGTCGTCTCCAGCGGTCGC
GGCACGGTGTTCAGCTTCGTGGTGCATCACGCGCCGAAAGTTCCGGGTCGCACGGTGCCC
TTCGTGATCGCGCTGGTGGAGCTCGAGGAAGGGGTACGCATGCTGGGCGAGCTGCGGGGG
GCCGATCCTGCTCGTGTTGCGATCGGTATGCCGGTACGAGCGACCTATATCGATTTCCCC
GACTGGAGCCTCTACGCATGGGAGCCTGACGAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) JC. Chang,MD. Miner,AK. Pandey,WP. Gill,NS. Harik,CM. Sassetti,DR. Sherman igr Genes and Mycobacterium tuberculosis cholesterol metabolism. J. Bacteriol. 2009
Interaction	Regulatory Rv3574	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) JC. Chang,MD. Miner,AK. Pandey,WP. Gill,NS. Harik,CM. Sassetti,DR. Sherman igr Genes and Mycobacterium tuberculosis cholesterol metabolism. J. Bacteriol. 2009
Interaction	Regulatory Rv3574	active	sourish10	2012-10-05
	Co-expression (Functional linkage) JC. Chang,MD. Miner,AK. Pandey,WP. Gill,NS. Harik,CM. Sassetti,DR. Sherman igr Genes and Mycobacterium tuberculosis cholesterol metabolism. J. Bacteriol. 2009
Interaction	Regulatory Rv3574	active	sourish10	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	sourish10	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	sourish10	2012-10-05
	Co-expression (Functional linkage) JC. Chang,MD. Miner,AK. Pandey,WP. Gill,NS. Harik,CM. Sassetti,DR. Sherman igr Genes and Mycobacterium tuberculosis cholesterol metabolism. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Term	EC:4.2.1.- Lyases. Carbon-oxygen lyases. Hydro-lyases. - NR	active	nsampson	2012-03-05
	Assay of protein purified to homogeneity from a heterlogous host authors,ST. Thomas,BC. VanderVen,DR. Sherman,DG. Russell,NS. Sampson Pathway profiling in Mycobacterium tuberculosis: elucidation of cholesterol-derived catabolite and enzymes that catalyze its metabolism. J. Biol. Chem. 2011
Other	product:3	active	rslayden	2012-03-05
	in preparation Thomas, Sampson
Term	EC:4.2.1.- Lyases. Carbon-oxygen lyases. Hydro-lyases. - NR	active	rslayden	2012-03-05
	in preparation Thomas, Sampson