Rv3550 - enoyl-CoA hydratase echA20

Expression: Most Significant Conditions for Rv3550

Protein Domains

Gene Information
Locus	Rv3550
Symbol	echA20
Gene Name	enoyl-CoA hydratase echA20
Location	3989153 - 3989896 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:744 bp Protein:248 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30169
Related Genes	MAP0516c MAV_0610 Mkms_4769 Mmcs_4683 MSMEG_6001 MT3654 MUL_4113 Mvan_5266 nfa5100 SAV6203
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3550
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3550 Transcript 1
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS*

Genomic Sequence

>Rv3550
ATGCCGATCACCTCCACCACGCCCGAACCGGGCATCGTCGCGGTCACCGTCGACTACCCG
CCGGTCAACGCCATCCCGTCGAAAGCGTGGTTCGACCTGGCCGACGCGGTGACGGCCGCG
GGCGCCAACTCCGACACCCGCGCGGTGATCCTGCGGGCCGAGGGGCGCGGCTTCAACGCC
GGGGTGGACATCAAAGAGATGCAACGAACCGAAGGTTTCACGGCGCTGATCGACGCCAAC
CGCGGCTGCTTCGCCGCATTCCGCGCCGTCTACGAGTGCGCGGTGCCGGTGATCGCCGCC
GTGAACGGATTCTGCGTGGGCGGCGGCATCGGCCTGGTCGGCAACTCCGACGTCATCGTG
GCCTCCGAGGACGCCACCTTCGGCCTGCCCGAGGTGGAACGGGGCGCGCTGGGCGCGGCC
ACGCACCTCTCGCGGCTGGTGCCCCAGCACCTGATGCGACGGCTGTTCTTTACGGCGGCC
ACCGTGGACGCGGCCACCTTGCAGCACTTCGGCTCGGTGCACGAGGTGGTGTCCCGCGAT
CAGCTGGACGAGGCCGCTTTGCGGGTGGCCCGCGACATCGCCGCCAAAGACACCCGGGTC
ATCCGCGCCGCCAAGGAGGCGCTGAACTTCATCGACGTGCAACGGGTCAATGCGAGTTAC
CGGATGGAGCAAGGTTTTACCTTCGAGCTCAACCTCGCCGGAGTCGCCGACGAGCACCGC
GACGCCTTTGTGAAGAAGTCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3557c	active	jgalag	2012-10-05
	Band shift KL. Fillgrove & VE. Anderson Orientation of coenzyme A substrates, nicotinamide and active site functional groups in (Di)enoyl-coenzyme A reductases. Biochemistry 2000
Interaction	Regulatory Rv3557c	active	jgalag	2012-10-05
	Band shift SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3334	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2175c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0823c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Name	enoyl-CoA hydratase	active	cstolte	2011-01-03
	Not directly confirmed as part of beta-oxidation, and could be other isozymes
Symbol	EchA20	active	cstolte	2011-01-03
	Not directly confirmed as part of beta-oxidation, and could be other isozymes
Name	enoyl-CoA hydratase	active	jgalag	2010-09-02
	Not directly confirmed as part of beta-oxidation, and could be other isozymes