Rv3551 - CoA-transferase alpha subunit

Expression: Most Significant Conditions for Rv3551

Protein Domains

Gene Information
Locus	Rv3551
Symbol
Gene Name	CoA-transferase alpha subunit
Location	3989896 - 3990774 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:879 bp Protein:293 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20193
Related Genes	Acel_1643 Acel_1644 MAP0514c MAP0515c MAV_0608 MAV_0609 Mkms_4770 Mkms_4771 Mmcs_4684 Mmcs_4685 MSMEG_6002 MSMEG_6003 MT3655 MT3656 MUL_4114 MUL_4115 Mvan_5267 Mvan_5268 nfa5080 nfa5090 Rv3552 SAV6201 SAV6202
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3551
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3551 Transcript 1
MPDKRTALDDAVAQLRSGMTIGIAGWGSRRKPMAFVRAILRSDVTDLTVVTYGGPDLGLL
CSAGKVKRVYYGFVSLDSPPFYDPWFAHARTSGAIEAREMDEGMLRCGLQAAAQRLPFLP
IRAGLGSSVPQFWAGELQTVTSPYPAPGGGYETLIAMPALRLDAAFAHLNLGDSHGNAAY
TGIDPYFDDLFLMAAERRFLSVERIVATEELVKSVPPQALLVNRMMVDAIVEAPGGAHFT
TAAPDYGRDEQFQRHYAEAASTQVGWQQFVHTYLSGTEADYQAAVHNFGASR*

Genomic Sequence

>Rv3551
GTGCCCGATAAACGAACCGCTCTTGACGACGCCGTCGCGCAATTGCGCAGCGGCATGACC
ATCGGCATCGCCGGCTGGGGCTCGCGGCGCAAGCCCATGGCGTTCGTGCGGGCCATCCTG
CGCTCGGATGTCACCGATTTGACGGTGGTCACCTACGGCGGGCCGGACCTGGGGCTGCTG
TGCTCGGCGGGCAAGGTCAAGCGGGTCTACTACGGGTTCGTCTCGCTGGACTCGCCGCCG
TTCTACGACCCGTGGTTCGCGCACGCCCGCACCAGCGGCGCGATCGAGGCCCGGGAGATG
GACGAGGGCATGCTGCGCTGCGGTTTGCAGGCCGCGGCACAACGGCTGCCGTTCCTGCCT
ATTCGCGCCGGGCTGGGCAGCTCGGTACCACAGTTCTGGGCAGGCGAGCTGCAGACGGTC
ACGTCGCCGTATCCGGCGCCTGGCGGCGGGTACGAGACACTGATCGCCATGCCGGCACTG
CGCCTGGATGCCGCCTTCGCCCACTTGAATCTCGGTGACAGCCACGGCAATGCGGCCTAC
ACCGGCATCGACCCCTACTTCGACGATCTCTTCTTGATGGCCGCCGAGCGGCGCTTTCTG
TCGGTGGAGCGCATCGTCGCCACCGAGGAACTGGTCAAATCGGTGCCGCCGCAGGCGCTG
TTGGTCAACCGGATGATGGTCGACGCCATCGTGGAAGCACCCGGCGGCGCCCACTTCACC
ACCGCCGCACCGGACTACGGGCGCGACGAGCAGTTCCAGCGGCACTACGCCGAAGCGGCG
TCGACACAGGTGGGTTGGCAGCAGTTCGTGCACACCTACCTATCCGGCACCGAAGCGGAC
TACCAGGCCGCGGTGCACAACTTTGGAGCATCACGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3557c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3557c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3334	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2175c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0823c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Term	EC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NR	active	nsampson	2012-03-05
	Reaction blocked in mutant authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005