Rv3569c - 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphD

Expression: Most Significant Conditions for Rv3569c

Protein Domains

Gene Information
Locus	Rv3569c
Symbol	bphD
Gene Name	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphD
Location	4010196 - 4011071 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:876 bp Protein:292 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	38078
Related Genes	CE2513 cg0466 cg0469 cg2912 DIP0616 DIP0625 DIP0628 jk0315 jk0318 jk0327 MAP0498 MAP1452c MAP1457 MAV_0592 MAV_3010 MAV_3016 Mkms_0333 Mkms_4794 Mmcs_0323 Mmcs_4708 MSMEG_2900 MSMEG_6037 MT3674 MUL_4140 Mvan_2898 Mvan_5307
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3569c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3569c Transcript 1
MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAASWTNFSRNIA
VLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLFDQLGLGRVPLVGNSLGGGTA
VRFALDYPARAGRLVLMGPGGLSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMVYD
KNLITPELVDQRFALASTPESLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGRE
DRVNPLDGALVALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR*

Genomic Sequence

>Rv3569c
ATGACAGCTACCGAGGAATTGACGTTCGAATCCACCTCGCGCTTTGCGGAAGTGGACGTC
GACGGGCCGCTGAAACTGCACTACCACGAGGCCGGCGTGGGCAACGACCAGACGGTGGTG
CTACTGCACGGCGGTGGGCCCGGCGCGGCGAGCTGGACGAACTTCTCGCGTAATATCGCG
GTGCTGGCGCGGCACTTTCATGTGCTGGCCGTCGACCAGCCCGGTTACGGCCATTCCGAC
AAGCGGGCCGAGCACGGCCAGTTCAATCGCTATGCCGCGATGGCGCTGAAGGGGCTCTTC
GATCAGCTGGGGCTGGGGCGGGTACCGCTGGTGGGCAACTCGTTGGGCGGGGGAACCGCG
GTCCGGTTTGCGCTGGACTACCCGGCCCGGGCAGGACGGTTAGTGCTGATGGGCCCGGGG
GGCCTGAGTATCAACCTGTTTGCGCCCGACCCGACCGAGGGAGTCAAACGGCTGTCGAAG
TTCTCCGTTGCGCCCACCCGGGAGAACCTCGAGGCGTTCCTGCGGGTCATGGTCTACGAC
AAGAACCTGATCACCCCCGAGTTGGTGGATCAGCGGTTTGCGCTGGCCAGCACCCCGGAG
TCGTTGACGGCAACACGGGCGATGGGAAAGTCGTTCGCCGGAGCCGACTTCGAGGCCGGC
ATGATGTGGCGCGAGGTGTATCGGCTGCGCCAGCCGGTGTTGCTGATCTGGGGTCGTGAG
GACCGGGTCAACCCGCTGGACGGCGCGCTGGTTGCGTTGAAAACGATTCCGCGTGCGCAG
CTGCACGTATTCGGGCAGTGTGGGCATTGGGTGCAGGTGGAGAAGTTCGACGAGTTCAAC
AAGCTGACGATTGAATTTCTGGGAGGTGGCAGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Other	EC:4.1.2.46	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from a heterlogous host authors,NA. Lack,KC. Yam,ED. Lowe,GP. Horsman,RL. Owen,E. Sim,LD. Eltis Characterization of a carbon-carbon hydrolase from Mycobacterium tuberculosis involved in cholesterol metabolism. J. Biol. Chem. 2010
Term	EC:4.1.2.37 Acetone-cyanohydrin lyase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from a heterlogous host authors,NA. Lack,KC. Yam,ED. Lowe,GP. Horsman,RL. Owen,E. Sim,LD. Eltis Characterization of a carbon-carbon hydrolase from Mycobacterium tuberculosis involved in cholesterol metabolism. J. Biol. Chem. 2010
Term	EC:3.7.1.- Hydrolases. Acting on carbon-carbon bonds. In ketonic substances. - NR	active	nsampson	2012-03-05
	Assay of protein purified to homogeneity from a heterlogous host authors,NA. Lack,KC. Yam,ED. Lowe,GP. Horsman,RL. Owen,E. Sim,LD. Eltis Characterization of a carbon-carbon hydrolase from Mycobacterium tuberculosis involved in cholesterol metabolism. J. Biol. Chem. 2010
Term	EC:3.7.1.- Hydrolases. Acting on carbon-carbon bonds. In ketonic substances. - NR	active	nsampson	2012-03-05
	Assay of unpurified protein expressed in a heterlogous host authors,R. Van der Geize,K. Yam,T. Heuser,MH. Wilbrink,H. Hara,MC. Anderton,E. Sim,L. Dijkhuizen,JE. Davies,WW. Mohn,LD. Eltis A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2007
Name	4,9-DSHA hydrolase ý	active	cstolte	2011-01-03
	Lack (2009)
Symbol	HsaD	active	cstolte	2011-01-03
	Lack (2009)
Name	4,9-DSHA hydrolase ý	active	jgalag	2010-09-02
	Lack (2009)
Symbol	HsaD	active	jgalag	2010-09-02
	Lack (2009)