Rv3575c - transcriptional regulator, laci-family

Expression: Most Significant Conditions for Rv3575c

Protein Domains

Gene Information
Locus	Rv3575c
Symbol
Gene Name	transcriptional regulator, laci-family
Location	4017089 - 4018168 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1080 bp Protein:360 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36819
Related Genes	BL1331 BL1332 BL1336 CE2511 cg2910 DIP1969 jk0329 MAP0490 MAV_0585 Mkms_4802 Mmcs_4716 MSMEG_6044 MT3680 MUL_4146 Mvan_5317 SAV7270 SAV7272 SAV7273
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3575c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3575c Transcript 1
MSPTPRRRATLASLAAELKVSRTTVSNAFNRPDQLSADLRERVLATAKRLGYAGPDPVAR
SLRTRKAGAVGLVMAEPLTYFFSDPAARDFVAGVAQSCEELGQGLQLVSVGSSRSLADGT
AAVLGAGVDGFVVYSVGDDDPYLQVVLQRRLPVVVVDQPKDLSGVSRVGIDDRAAMRELA
GYVLGLGHRELGLLTMRLGRDRRQDLVDAERLRSPTFDVQRERIVGVWEAMTAAGVDPDS
LTVVESYEHLPTSGGTAAKVALQANPRLTALMCTADILALSAMDYLRAHGIYVPGQMTVT
GFDGVPEALSRGLTTVAQPSLHKGHRAGELLLKPPRSGLPVIEVLDTELVRGRTAGPPA*

Genomic Sequence

>Rv3575c
GTGAGTCCCACACCGCGGAGGCGGGCGACTCTGGCGTCGTTAGCAGCCGAGCTCAAGGTG
TCCCGCACCACTGTCTCGAATGCTTTTAACCGACCGGATCAGCTCTCCGCCGATCTACGT
GAACGAGTGCTTGCCACGGCCAAGCGACTGGGCTATGCCGGACCGGATCCGGTGGCGCGA
TCGTTGCGGACCCGCAAAGCCGGTGCGGTCGGTTTGGTGATGGCCGAACCGCTGACCTAT
TTCTTCAGCGACCCGGCCGCGCGGGATTTTGTTGCGGGAGTGGCGCAGTCGTGCGAAGAG
CTGGGGCAGGGCCTGCAGCTGGTTTCCGTCGGCTCCAGTCGGAGCCTTGCGGACGGCACA
GCTGCCGTGCTCGGCGCTGGGGTGGACGGCTTCGTGGTGTATTCGGTAGGCGACGACGAT
CCCTACCTGCAGGTCGTGCTGCAGCGGCGGCTGCCGGTGGTGGTGGTCGACCAGCCCAAA
GACCTCTCCGGAGTGTCCCGGGTCGGCATCGACGACCGGGCGGCGATGCGTGAGCTTGCC
GGCTACGTACTCGGGTTGGGGCATCGCGAGCTCGGCCTGCTGACCATGCGGCTGGGACGG
GATCGGCGGCAAGACTTGGTGGACGCCGAGCGGCTGCGGTCGCCGACCTTCGACGTACAG
CGCGAACGCATCGTCGGCGTATGGGAGGCGATGACGGCCGCCGGCGTCGACCCGGACTCG
CTGACCGTGGTGGAAAGCTACGAGCATTTGCCGACGTCCGGCGGCACTGCCGCCAAGGTG
GCTCTGCAGGCCAATCCGCGGCTGACCGCGCTGATGTGCACAGCGGACATCTTGGCGCTC
TCAGCTATGGATTACCTTCGGGCGCACGGGATTTACGTGCCCGGGCAGATGACCGTCACA
GGGTTTGACGGAGTGCCAGAGGCGCTGAGCCGGGGGCTGACCACGGTCGCGCAGCCGAGT
CTGCACAAGGGGCACCGGGCGGGCGAGCTATTGCTGAAGCCGCCGCGGTCCGGACTGCCC
GTCATCGAGGTGCTCGATACCGAGCTGGTCCGGGGCCGCACCGCGGGTCCGCCGGCGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3411c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3396c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3276c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3275c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2919c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2211c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2139	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1832	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1826	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1017c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0957	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0956	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0809	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0808	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0803	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0780	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0777	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0772	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0070c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv3411c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv3396c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv3276c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv3275c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv2919c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv2211c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv2139	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1832	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1826	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1017c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0957	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0956	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0809	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0808	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0803	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0780	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0777	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0772	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0070c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006