Rv3613c - hypothetical protein

Expression: Most Significant Conditions for Rv3613c

Protein Domains

Gene Information
Locus	Rv3613c
Symbol
Gene Name	hypothetical protein
Location	4053881 - 4054042 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:162 bp Protein:54 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9266
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3613c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3613c Transcript 1
MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL*

Genomic Sequence

>Rv3613c
ATGTGCACAATGCCAAAGCTTTGGCGCGCCTTCATGGCGGGCCGGCCGCTCGGGAGCACC
TTCACGCCCAGACAGCCAACCGGGGCTGCGCCGAACCACGTTCGCGCGCTGGATGACTCA
ATTGACCCGAGTTCTGCTCCCGCTGCCCGTGCTGCTCTTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	RegulatedBy Rv3849	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008