Rv3619c - Esat-6 like protein esxV

Expression: Most Significant Conditions for Rv3619c

Protein Domains

Gene Information
Locus	Rv3619c
Symbol	esxV
Gene Name	Esat-6 like protein esxV
Location	4059984 - 4060268 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:285 bp Protein:95 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11463
Related Genes	MT3721 MUL_1456
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3619c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3619c Transcript 1
MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRN
FQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA*

Genomic Sequence

>Rv3619c
ATGACCATCAACTATCAATTCGGGGACGTCGACGCTCACGGCGCCATGATCCGCGCTCAG
GCCGGGTCGCTGGAGGCCGAGCATCAGGCCATCATTTCTGATGTGTTGACCGCGAGTGAC
TTTTGGGGCGGCGCCGGTTCGGCGGCCTGCCAGGGGTTCATTACCCAGCTGGGCCGTAAC
TTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAAC
AACATGGCACAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,UN. Wiesmann,S. DiDonato,NN. Herschkowitz Effect of chloroquine on cultured fibroblasts: release of lysosomal hydrolases and inhibition of their uptake. Biochem. Biophys. Res. Commun. 1975
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	Activation Rv3620c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) M. Marmiesse, P. Brodin et al. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2004