Rv3675 - membrane protein

Expression: Most Significant Conditions for Rv3675

Protein Domains

Gene Information
Locus	Rv3675
Symbol
Gene Name	membrane protein
Location	4116002 - 4116379 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:378 bp Protein:126 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6765
Related Genes	MAP0399c MAV_0454 Mkms_4903 Mmcs_4817 MSMEG_6188 MT3776 MUL_4249 Mvan_5434
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3675
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3675 Transcript 1
MFTLLVSWLLVACVPGLLMLATLGLGRLERFLARDTVTATDVAEFLEQAEAVDVHTLARN
GMPEALDYLHRRQARRITDSPPLGSGAGPRYAGPLFVTDLDSPVEPPRHGQPNPQFRTAR
HANHV*

Genomic Sequence

>Rv3675
ATGTTTACTCTCCTTGTGTCATGGTTGCTCGTGGCCTGCGTTCCTGGGTTGTTGATGCTG
GCGACCCTCGGGTTGGGACGGCTGGAAAGGTTTCTGGCCCGAGACACGGTCACGGCGACC
GACGTCGCGGAGTTTCTCGAGCAGGCCGAGGCCGTGGATGTGCATACGCTCGCTCGGAAT
GGAATGCCGGAGGCGCTGGATTACCTGCATCGACGTCAAGCCCGGCGAATCACCGATTCA
CCGCCGCTTGGGTCTGGCGCTGGGCCACGGTATGCCGGGCCGCTGTTTGTCACCGATCTC
GATAGCCCCGTCGAGCCACCCCGGCATGGCCAGCCCAATCCGCAGTTTAGAACGGCTCGA
CACGCAAATCACGTGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3414c	active	jhum4u2006	2012-10-05
	Co-expression (Functional linkage) authors,V. Makarov,G. Manina,K. Mikusova,U. Möllmann,O. Ryabova,B. Saint-Joanis,N. Dhar,MR. Pasca,S. Buroni,AP. Lucarelli,A. Milano,E. De Rossi,M. Belanova,A. Bobovska,P. Dianiskova,J. Kordulakova,C. Sala,E. Fullam,P. Schneider,JD. McKinney,P. Brodin,T. Christophe,S. Waddell,P. Butcher,J. Albrethsen,I. Rosenkrands,R. Brosch,V. Nandi,S. Bharath,S. Gaonkar,RK. Shandil,V. Balasubramanian,T. Balganesh,S. Tyagi,J. Grosset,G. Riccardi,ST. Cole Benzothiazinones kill Mycobacterium tuberculosis by blocking arabinan synthesis. Science 2009
Interaction	Regulatory Rv3414c	active	jhum4u2006	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Regulatory Rv3414c	active	jhum4u2006	2012-10-03
	Co-expression (Functional linkage) authors,V. Makarov,G. Manina,K. Mikusova,U. Möllmann,O. Ryabova,B. Saint-Joanis,N. Dhar,MR. Pasca,S. Buroni,AP. Lucarelli,A. Milano,E. De Rossi,M. Belanova,A. Bobovska,P. Dianiskova,J. Kordulakova,C. Sala,E. Fullam,P. Schneider,JD. McKinney,P. Brodin,T. Christophe,S. Waddell,P. Butcher,J. Albrethsen,I. Rosenkrands,R. Brosch,V. Nandi,S. Bharath,S. Gaonkar,RK. Shandil,V. Balasubramanian,T. Balganesh,S. Tyagi,J. Grosset,G. Riccardi,ST. Cole Benzothiazinones kill Mycobacterium tuberculosis by blocking arabinan synthesis. Science 2009
Interaction	Regulatory Rv3414c	active	jhum4u2006	2012-10-03
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004