Rv3687c - anti-anti-sigma factor rsfB

Expression: Most Significant Conditions for Rv3687c

Protein Domains

Gene Information
Locus	Rv3687c
Symbol	rsfB
Gene Name	anti-anti-sigma factor rsfB
Location	4129323 - 4129691 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:369 bp Protein:123 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20045
Related Genes	MAP0380 MAP4309 MAV_0435 MAV_5272 Mkms_2758 Mkms_5246 Mmcs_2714 Mmcs_5157 MSMEG_6127 MT3789 Mvan_1481 Mvan_3003 Mvan_4702 nfa34230 SAV1091 SAV1102 SAV235
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3687c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3687c Transcript 1
MSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLG
SVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRI
DR*

Genomic Sequence

>Rv3687c
TTGTCAGCTCCCGACTCGATCACCGTCACGGTTGCCGACCATAACGGGGTCGCCGTGCTC
AGCATCGGTGGTGAGATTGATTTGATCACCGCTGCGGCACTTGAAGAGGCCATCGGCGAA
GTTGTGGCCGACAATCCGACGGCGCTAGTCATCGACCTTTCCGCGGTGGAGTTTCTGGGG
TCGGTGGGGCTGAAGATTTTGGCGGCAACATCCGAAAAGATAGGCCAATCCGTCAAGTTC
GGGGTGGTTGCACGGGGTTCGGTAACCAGAAGGCCGATTCATCTGATGGGTCTGGACAAG
ACCTTTCGGTTGTTTTCCACGCTCCACGATGCCTTGACTGGGGTACGGGGCGGCAGGATC
GACCGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3287c	active	akankshajain.21	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007