Rv3757c - osmoprotectant proW

Expression: Most Significant Conditions for Rv3757c

Protein Domains

Gene Information
Locus	Rv3757c
Symbol	proW
Gene Name	osmoprotectant proW
Location	4202610 - 4203299 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:690 bp Protein:230 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37540
Related Genes	MAP0274 MAP0275 MAV_0319 MAV_0320 Mkms_5052 Mkms_5053 Mmcs_4964 Mmcs_4965 MSMEG_6331 MSMEG_6332 MT3863 MT3864 MUL_0032 MUL_0034 MUL_4374 MUL_4375 Mvan_5598 Mvan_5599 nfa32510 Rv3756c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3757c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3757c Transcript 1
MHYLMTHPGAAWALTVVHLRLSLLPVLIGLMSAVPLGLLVQRAPLLRRLTTATASVIFTI
PSLALFVVLPLIIGTRILDEANVIVALAAYTTALLVRAVLEALDAVPAQVHDAATAIGYS
RIAQMLKVELPLSIPVLVAGLRVVAVTNIAMVSVGSVIGIGGLGTWFTAGYQTNKSDQIV
AGVVAMFLLAIVVDVVINLAGRLATPWERAPRAARRRRQVAAPITGGAR*

Genomic Sequence

>Rv3757c
ATGCACTACCTGATGACCCACCCGGGAGCGGCCTGGGCGCTGACCGTCGTCCATCTGCGC
CTCTCGTTGCTGCCGGTGCTGATCGGGCTGATGAGCGCGGTGCCGTTGGGCCTGCTGGTG
CAGCGCGCGCCGCTGCTTCGCCGGCTGACGACGGCGACCGCCAGCGTTATATTCACCATC
CCGTCGCTAGCGCTATTCGTGGTGTTGCCGCTGATCATCGGAACCCGGATCCTCGACGAG
GCCAATGTCATTGTGGCGTTGGCGGCCTACACCACGGCCCTGCTGGTGCGGGCGGTGCTC
GAAGCGCTGGACGCGGTGCCGGCGCAGGTGCATGACGCGGCCACCGCCATCGGCTATTCG
CGGATCGCTCAGATGTTGAAAGTCGAACTGCCGCTGTCTATCCCCGTGCTGGTAGCCGGG
CTGCGGGTGGTCGCGGTTACCAACATCGCGATGGTGTCCGTGGGTTCGGTGATAGGAATC
GGGGGCCTGGGAACCTGGTTCACCGCGGGGTATCAGACCAACAAGAGTGACCAGATCGTT
GCCGGCGTCGTAGCGATGTTCCTGCTGGCGATTGTCGTCGACGTGGTGATCAACCTCGCC
GGTCGGCTGGCCACGCCATGGGAACGGGCGCCGCGGGCAGCCCGTCGGCGCCGCCAGGTC
GCGGCCCCGATCACGGGCGGAGCGCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3759c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3759c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv3758c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3758c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv3759c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3758c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3756c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3759c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv3758c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv3756c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv3756c	active	jgalag	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv3756c	active	jgalag	2012-10-05
	KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000