Rv3871 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3871

Protein Domains

Gene Information
Locus	Rv3871
Symbol
Gene Name	conserved hypothetical protein
Location	4348827 - 4350602 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1776 bp Protein:592 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34553
Related Genes	Mkms_0076 ML0052 ML0053 Mmcs_0067 MSMEG_0062 MT3983 MT3985 Mvan_0075 Rv3870
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3871
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3871 Transcript 1
MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQPLRFALGIMDE
PRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMSAAATHSPRNVQFYCIDLGGG
GLIYLENLPHVGGVANRSEPDKVNRVVAEMQAVMRQRETTFKEHRVGSIGMYRQLRDDPS
QPVASDPYGDVFLIIDGWPGFVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRV
RDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLV
EAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEIPIGLRETDLT
PAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQQVRFMLADYRSGLLDAVPDT
HLLGAGAINRNSASLDEAVQALAVNLKKRLPPTDLTTAQLRSRSWWSGFDVVLLVDDWHM
IVGAAGGMPPMAPLAPLLPAAADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLS
GEKQEFPSSEFKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG*

Genomic Sequence

>Rv3871
ATGACTGCTGAACCGGAAGTACGGACGCTGCGCGAGGTTGTGCTGGACCAGCTCGGCACT
GCTGAATCGCGTGCGTACAAGATGTGGCTGCCGCCGTTGACCAATCCGGTCCCGCTCAAC
GAGCTCATCGCCCGTGATCGGCGACAACCCCTGCGATTTGCCCTGGGGATCATGGATGAA
CCGCGCCGCCATCTACAGGATGTGTGGGGCGTAGACGTTTCCGGGGCCGGCGGCAACATC
GGTATTGGGGGCGCACCTCAAACCGGGAAGTCGACGCTACTGCAGACGATGGTGATGTCG
GCCGCCGCCACACACTCACCGCGCAACGTTCAGTTCTATTGCATCGACCTAGGTGGCGGC
GGGCTGATCTATCTCGAAAACCTTCCACACGTCGGTGGGGTAGCCAATCGGTCCGAGCCC
GACAAGGTCAACCGGGTGGTCGCAGAGATGCAAGCCGTCATGCGGCAACGGGAAACCACC
TTCAAGGAACACCGAGTGGGCTCGATCGGGATGTACCGGCAGCTGCGTGACGATCCAAGT
CAACCCGTTGCGTCCGATCCATACGGCGACGTCTTTCTGATCATCGACGGATGGCCCGGT
TTTGTCGGCGAGTTCCCCGACCTTGAGGGGCAGGTTCAAGATCTGGCCGCCCAGGGGCTG
GCGTTCGGCGTCCACGTCATCATCTCCACGCCACGCTGGACAGAGCTGAAGTCGCGTGTT
CGCGACTACCTCGGCACCAAGATCGAGTTCCGGCTTGGTGACGTCAATGAAACCCAGATC
GACCGGATTACCCGCGAGATCCCGGCGAATCGTCCGGGTCGGGCAGTGTCGATGGAAAAG
CACCATCTGATGATCGGCGTGCCCAGGTTCGACGGCGTGCACAGCGCCGATAACCTGGTG
GAGGCGATCACCGCGGGGGTGACGCAGATCGCTTCCCAGCACACCGAACAGGCACCTCCG
GTGCGGGTCCTGCCGGAGCGTATCCACCTGCACGAACTCGACCCGAACCCGCCGGGACCA
GAGTCCGACTACCGCACTCGCTGGGAGATTCCGATCGGCTTGCGCGAGACGGACCTGACG
CCGGCTCACTGCCACATGCACACGAACCCGCACCTACTGATCTTCGGTGCGGCCAAATCG
GGCAAGACGACCATTGCCCACGCGATCGCGCGCGCCATTTGTGCCCGAAACAGTCCCCAG
CAGGTGCGGTTCATGCTCGCGGACTACCGCTCGGGCCTGCTGGACGCGGTGCCGGACACC
CATCTGCTGGGCGCCGGCGCGATCAACCGCAACAGCGCGTCGCTAGACGAGGCCGTTCAA
GCACTGGCGGTCAACCTGAAGAAGCGGTTGCCGCCGACCGACCTGACGACGGCGCAGCTA
CGCTCGCGTTCGTGGTGGAGCGGATTTGACGTCGTGCTTCTGGTCGACGATTGGCACATG
ATCGTGGGTGCCGCCGGGGGGATGCCGCCGATGGCACCGCTGGCCCCGTTATTGCCGGCG
GCGGCAGATATCGGGTTGCACATCATTGTCACCTGTCAGATGAGCCAGGCTTACAAGGCA
ACCATGGACAAGTTCGTCGGCGCCGCATTCGGGTCGGGCGCTCCGACAATGTTCCTTTCG
GGCGAGAAGCAGGAATTCCCATCCAGTGAGTTCAAGGTCAAGCGGCGCCCCCCTGGCCAG
GCATTTCTCGTCTCGCCAGACGGCAAAGAGGTCATCCAGGCCCCCTACATCGAGCCTCCA
GAAGAAGTGTTCGCAGCACCCCCAAGCGCCGGTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3877	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3870	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3869	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3877	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3870	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3869	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3877	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3870	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3869	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3870	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3870	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3869	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3869	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006