Rv3893c - PE family protein

Expression: Most Significant Conditions for Rv3893c

Protein Domains

Gene Information
Locus	Rv3893c
Symbol	PE36
Gene Name	PE family protein
Location	4375762 - 4375995 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:234 bp Protein:78 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9285
Related Genes	MAP0157 MAV_0151 MT4008
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3893c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3893c Transcript 1
MVWSVQPEAVLASAAAESAISAETEAAAAGAAPALLSTTPMGGDPDSAMFSAALNACGAS
YLGVVAEHASQRGLFAG*

Genomic Sequence

>Rv3893c
ATGGTTTGGTCTGTGCAACCAGAAGCAGTGCTGGCGTCGGCAGCTGCCGAGTCGGCGATC
AGTGCGGAAACCGAGGCAGCGGCCGCCGGAGCGGCGCCAGCCCTGCTTAGCACCACGCCG
ATGGGTGGTGATCCCGACTCCGCGATGTTCTCCGCAGCGCTCAACGCGTGCGGTGCCAGC
TACCTGGGTGTCGTTGCCGAACACGCCAGTCAGCGCGGCCTGTTCGCGGGTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	PhysicalInteraction Rv3892c	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008