Rv3905c - Esat-6 like protein esxF

Expression: Most Significant Conditions for Rv3905c

Protein Domains

Gene Information
Locus	Rv3905c
Symbol	esxF
Gene Name	Esat-6 like protein esxF
Location	4390720 - 4391031 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:312 bp Protein:104 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9287
Related Genes	MAP4000c MAV_4642 MT4024 MUL_5055
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3905c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3905c Transcript 1
MGADDTLRVEPAVMQGFAASLDGAAEHLAVQLAELDAQVGQMLGGWRGASGSAYGSAWEL
WHRGAGEVQLGLSMLAAAIAHAGAGYQHNETASAQVLREVGGG*

Genomic Sequence

>Rv3905c
ATGGGTGCCGACGACACGCTGCGCGTAGAGCCTGCGGTGATGCAGGGTTTCGCCGCGTCG
TTGGATGGAGCGGCCGAGCATCTCGCGGTTCAACTGGCCGAGCTGGACGCTCAGGTCGGG
CAGATGTTGGGCGGGTGGCGCGGGGCGTCGGGCAGTGCGTATGGCTCGGCGTGGGAGCTA
TGGCATCGCGGGGCCGGTGAGGTGCAGCTGGGATTGTCGATGCTGGCGGCGGCGATAGCT
CACGCCGGTGCGGGTTATCAACACAACGAGACCGCGTCGGCGCAGGTGCTTCGTGAGGTG
GGCGGTGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) R. Manganelli,E. Dubnau,S. Tyagi,FR. Kramer,I. Smith Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Mol. Microbiol. 1999
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	active	sourish10	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	active	sourish10	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3906c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3906c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	active	shahanup86	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007