Rv3804c - secreted fibronectin-binding protein antigen fbpA

Expression: Most Significant Conditions for Rv3804c

Protein Domains

Gene Information
Locus	Rv3804c
Symbol	fbpA
Gene Name	secreted fibronectin-binding protein antigen fbpA
Location	4265642 - 4266658 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1017 bp Protein:339 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22785
Related Genes	MAP0216 MAV_0214 Mkms_5102 Mkms_5103 ML0097 ML0098 Mmcs_5014 Mmcs_5015 MSMEG_6396 MSMEG_6398 MSMEG_6399 MT3910 MT3911 MUL_4986 MUL_4987 Mvan_5644 Mvan_5645 nfa1810 nfa1820 nfa1830 Rv3803c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3804c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3804c Transcript 1
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS
MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS
FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI
YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV
GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA*

Genomic Sequence

>Rv3804c
ATGCAGCTTGTTGACAGGGTTCGTGGCGCCGTCACGGGTATGTCGCGTCGACTCGTGGTC
GGGGCCGTCGGCGCGGCCCTAGTGTCGGGTCTGGTCGGCGCCGTCGGTGGCACGGCGACC
GCGGGGGCATTTTCCCGGCCGGGCTTGCCGGTGGAGTACCTGCAGGTGCCGTCGCCGTCG
ATGGGCCGTGACATCAAGGTCCAATTCCAAAGTGGTGGTGCCAACTCGCCCGCCCTGTAC
CTGCTCGACGGCCTGCGCGCGCAGGACGACTTCAGCGGCTGGGACATCAACACCCCGGCG
TTCGAGTGGTACGACCAGTCGGGCCTGTCGGTGGTCATGCCGGTGGGTGGCCAGTCAAGC
TTCTACTCCGACTGGTACCAGCCCGCCTGCGGCAAGGCCGGTTGCCAGACTTACAAGTGG
GAGACCTTCCTGACCAGCGAGCTGCCGGGGTGGCTGCAGGCCAACAGGCACGTCAAGCCC
ACCGGAAGCGCCGTCGTCGGTCTTTCGATGGCTGCTTCTTCGGCGCTGACGCTGGCGATC
TATCACCCCCAGCAGTTCGTCTACGCGGGAGCGATGTCGGGCCTGTTGGACCCCTCCCAG
GCGATGGGTCCCACCCTGATCGGCCTGGCGATGGGTGACGCTGGCGGCTACAAGGCCTCC
GACATGTGGGGCCCGAAGGAGGACCCGGCGTGGCAGCGCAACGACCCGCTGTTGAACGTC
GGGAAGCTGATCGCCAACAACACCCGCGTCTGGGTGTACTGCGGCAACGGCAAGCCGTCG
GATCTGGGTGGCAACAACCTGCCGGCCAAGTTCCTCGAGGGCTTCGTGCGGACCAGCAAC
ATCAAGTTCCAAGACGCCTACAACGCCGGTGGCGGCCACAACGGCGTGTTCGACTTCCCG
GACAGCGGTACGCACAGCTGGGAGTACTGGGGCGCGCAGCTCAACGCTATGAAGCCCGAC
CTGCAACGGGCACTGGGTGCCACGCCCAACACCGGGCCCGCGCCCCAGGGCGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name	acyl CoA:diacylglycerol acyltransferase	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Name	acyl CoA:diacylglycerol acyltransferase	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Name	mycolyltransferase 85A;INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Name	mycolyltransferase 85A;INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Symbol	Ag85A	active	jlew	2012-03-07
	Tat substrate. Demonstrated by experimental verification that four secreted proteins from Mtb carrying putative Tat signals are bona fide Tat substrates M. Marrichi, L. Camacho et al. Genetic Toggling of Alkaline Phosphatase Folding Reveals Signal Peptides for All Major Modes of Transport across the Inner Membrane of Bacteria. J. Biol. Chem. 2008
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Other	TBPWY:Triglyceride biosynthesis	active	mjackson	2012-03-05
	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) authors,AA. Elamin,M. Stehr,R. Spallek,M. Rohde,M. Singh The Mycobacterium tuberculosis Ag85A is a novel diacylglycerol acyltransferase involved in lipid body formation. Mol. Microbiol. 2011
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001