Rv0005 - DNA gyrase subunit B gyrB

Expression: Most Significant Conditions for Rv0005

Protein Domains

Gene Information
Locus	Rv0005
Symbol	gyrB
Gene Name	DNA gyrase subunit B gyrB
Location	5123 - 7267 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2145 bp Protein:715 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32893
Related Genes	Acel_0005 BL0635 CE0006 cg0007 DIP0005 jk0005 MAP0005 MAV_0005 Mkms_0014 ML0005 Mmcs_0006 MSMEG_0005 MT0005 MUL_0005 Mvan_0006 nfa60 PPA0009 SAV4321
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0005
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0005 Transcript 1
MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKKKAQDEYGAASITILE
GLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDG
RGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKR
DGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFLN
KGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTAPHKVKSRTFHYPGGLVDFV
KHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFR
SALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVK
SFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGK
LADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTE
VQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHV
FLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKEL
WETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV*

Genomic Sequence

>Rv0005
ATGGGTAAAAACGAGGCCAGAAGATCGGCCCTGGCGCCCGATCACGGTACAGTGGTGTGC
GACCCCCTGCGGCGACTCAACCGCATGCACGCAACCCCTGAGGAGAGTATTCGGATCGTG
GCTGCCCAGAAAAAGAAGGCCCAAGACGAATACGGCGCTGCGTCTATCACCATTCTCGAA
GGGCTGGAGGCCGTCCGCAAACGTCCCGGCATGTACATTGGCTCGACCGGTGAGCGCGGT
TTACACCATCTCATTTGGGAGGTGGTCGACAACGCGGTCGACGAGGCGATGGCCGGTTAT
GCAACCACAGTGAACGTAGTGCTGCTTGAGGATGGCGGTGTCGAGGTCGCCGACGACGGC
CGCGGCATTCCGGTCGCCACCCACGCCTCCGGCATACCGACCGTCGACGTGGTGATGACA
CAACTACATGCCGGCGGCAAGTTCGACTCGGACGCGTATGCGATATCTGGTGGTCTGCAC
GGCGTCGGCGTGTCGGTGGTTAACGCGCTATCCACCCGGCTCGAAGTCGAGATCAAGCGC
GACGGGTACGAGTGGTCTCAGGTTTATGAGAAGTCGGAACCCCTGGGCCTCAAGCAAGGG
GCGCCGACCAAGAAGACGGGGTCAACGGTGCGGTTCTGGGCCGACCCCGCTGTTTTCGAA
ACCACGGAATACGACTTCGAAACCGTCGCCCGCCGGCTGCAAGAGATGGCGTTCCTCAAC
AAGGGGCTGACCATCAACCTGACCGACGAGAGGGTGACCCAAGACGAGGTCGTCGACGAA
GTGGTCAGCGACGTCGCCGAGGCGCCGAAGTCGGCAAGTGAACGCGCAGCCGAATCCACT
GCACCGCACAAAGTTAAGAGCCGCACCTTTCACTATCCGGGTGGCCTGGTGGACTTCGTG
AAACACATCAACCGCACCAAGAACGCGATTCATAGCAGCATCGTGGACTTTTCCGGCAAG
GGCACCGGGCACGAGGTGGAGATCGCGATGCAATGGAACGCCGGGTATTCGGAGTCGGTG
CACACCTTCGCCAACACCATCAACACCCACGAGGGCGGCACCCACGAAGAGGGCTTCCGC
AGCGCGCTGACGTCGGTGGTGAACAAGTACGCCAAGGACCGCAAGCTACTGAAGGACAAG
GACCCCAACCTCACCGGTGACGATATCCGGGAAGGCCTGGCCGCTGTGATCTCGGTGAAG
GTCAGCGAACCGCAGTTCGAGGGCCAGACCAAGACCAAGTTGGGCAACACCGAGGTCAAA
TCGTTTGTGCAGAAGGTCTGTAACGAACAGCTGACCCACTGGTTTGAAGCCAACCCCACC
GACGCGAAAGTCGTTGTGAACAAGGCTGTGTCCTCGGCGCAAGCCCGTATCGCGGCACGT
AAGGCACGAGAGTTGGTGCGGCGTAAGAGCGCCACCGACATCGGTGGATTGCCCGGCAAG
CTGGCCGATTGCCGTTCCACGGATCCGCGCAAGTCCGAACTGTATGTCGTAGAAGGTGAC
TCGGCCGGCGGTTCTGCAAAAAGCGGTCGCGATTCGATGTTCCAGGCGATACTTCCGCTG
CGCGGCAAGATCATCAATGTGGAGAAAGCGCGCATCGACCGGGTGCTAAAGAACACCGAA
GTTCAGGCGATCATCACGGCGCTGGGCACCGGGATCCACGACGAGTTCGATATCGGCAAG
CTGCGCTACCACAAGATCGTGCTGATGGCCGACGCCGATGTTGACGGCCAACATATTTCC
ACGCTGTTGTTGACGTTGTTGTTCCGGTTCATGCGGCCGCTCATCGAGAACGGGCATGTG
TTTTTGGCACAACCGCCGCTGTACAAACTCAAGTGGCAGCGCAGTGACCCGGAATTCGCA
TACTCCGACCGCGAGCGCGACGGTCTGCTGGAGGCGGGGCTGAAGGCCGGGAAGAAGATC
AACAAGGAAGACGGCATTCAGCGGTACAAGGGTCTAGGTGAAATGGACGCTAAGGAGTTG
TGGGAGACCACCATGGATCCCTCGGTTCGTGTGTTGCGTCAAGTGACGCTGGACGACGCC
GCCGCCGCCGACGAGTTGTTCTCCATCCTGATGGGCGAGGACGTCGACGCGCGGCGCAGC
TTTATCACCCGCAACGCCAAGGATGTTCGGTTCCTGGATGTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) UH. Manjunatha, S. Mahadevan et al. Monoclonal antibodies to mycobacterial DNA gyrase A inhibit DNA supercoiling activity. Eur. J. Biochem. 2001
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Aubry, XS. Pan et al. Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. Antimicrob. Agents Chemother. 2004
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) X. Yin & Z. Yu Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. The Journal of infection 2010
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) S. Niemann, D. Harmsen et al. Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. J. Clin. Microbiol. 2000
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) HE. Takiff, L. Salazar et al. Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. Antimicrob. Agents Chemother. 1994
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) KS. Goh, M. Fabre et al. Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. Mol. Cell. Probes null
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction	PhysicalInteraction Rv0006	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. Nucleic Acids Res. 2009