Rv0015c - transmembrane serine/threonine-protein kinase A pknA

Expression: Most Significant Conditions for Rv0015c

Protein Domains

Gene Information
Locus	Rv0015c
Symbol	pknA
Gene Name	transmembrane serine/threonine-protein kinase A pknA
Location	17467 - 18762 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1296 bp Protein:432 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36629
Related Genes	MAP0017c MAP0018c MAV_0019 Mkms_0024 ML0017 Mmcs_0016 MSMEG_0030 MT0018 MUL_0019 Mvan_0024 nfa810
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0015c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0015c Transcript 1
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRA
EARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVI
KAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTERGETRHSGLQSWVVPPTPHS
RASLARYEIAQ*

Genomic Sequence

>Rv0015c
ATGAGCCCCCGAGTTGGCGTGACGCTGTCGGGCAGATACCGCCTGCAGCGCCTCATCGCC
ACCGGTGGTATGGGCCAAGTCTGGGAGGCCGTGGATAACCGGTTGGGCCGGCGTGTTGCG
GTGAAGGTGCTCAAGAGCGAGTTCTCCTCCGATCCGGAGTTCATCGAACGGTTCCGGGCC
GAAGCGCGCACCACCGCGATGCTGAACCATCCGGGCATCGCCAGCGTGCACGACTACGGC
GAAAGCCAGATGAACGGGGAGGGTCGCACGGCCTACCTGGTGATGGAGCTGGTCAACGGC
GAGCCACTAAATTCGGTGCTCAAACGCACCGGCCGGCTGTCGTTGCGGCACGCACTGGAC
ATGCTCGAGCAGACCGGCCGCGCTCTGCAGATCGCGCATGCCGCTGGCCTGGTGCACCGC
GACGTCAAACCGGGCAACATCTTGATCACCCCCACCGGGCAGGTGAAGATCACCGACTTC
GGCATCGCCAAAGCCGTCGATGCAGCGCCCGTGACCCAGACCGGCATGGTGATGGGCACC
GCCCAATACATCGCGCCGGAGCAGGCCCTCGGTCACGACGCCAGCCCGGCCAGCGACGTC
TATTCACTGGGAGTTGTTGGGTATGAAGCGGTTTCGGGTAAACGGCCGTTCGCCGGCGAT
GGTGCCCTGACCGTGGCAATGAAGCACATCAAGGAGCCGCCGCCGCCGCTGCCTCCCGAC
CTGCCGCCCAATGTGCGAGAACTCATCGAGATAACTCTGGTGAAGAACCCCGCGATGCGC
TATCGCAGTGGGGGACCGTTCGCCGACGCGGTGGCAGCGGTGCGCGCCGGCCGCCGGCCC
CCGCGGCCCAGCCAGACACCCCCCCCTGGCCGGGCCGCCCCGGCGGCCATTCCGTCGGGT
ACGACAGCCAGGGTCGCGGCCAACTCTGCTGGCCGGACTGCGGCATCCCGTCGATCCCGC
CCGGCCACGGGTGGTCACCGGCCGCCGCGGCGCACGTTTTCGTCCGGTCAGCGTGCGCTG
CTCTGGGCCGCGGGGGTGCTGGGGGCGCTGGCAATCATCATCGCCGTGCTGCTCGTCATC
AAAGCGCCCGGGGACAACAGCCCGCAGCAGGCACCGACGCCGACCGTGACCACCACCGGG
AACCCTCCGGCCAGCAACACTGGCGGGACTGATGCTAGCCCGCGACTCAATTGGACGGAA
CGCGGGGAAACACGTCATTCTGGACTGCAAAGCTGGGTTGTCCCGCCGACACCGCATTCG
CGCGCGTCGCTGGCCCGATACGAGATAGCGCAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,OW. Schonecke,W. Schüffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv2145c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
Interaction	Signaling Rv0018c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis B. Boitel, M. Ortiz-Lombardía et al. PknB kinase activity is regulated by phosphorylation in two Thr residues and dephosphorylation by PstP, the cognate phospho-Ser/Thr phosphatase, in Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Signaling Rv0018c	active	vmevada102	2012-10-05
	Spectrophotometric Analysis P. Chopra, B. Singh et al. Phosphoprotein phosphatase of Mycobacterium tuberculosis dephosphorylates serine-threonine kinases PknA and PknB. Biochem. Biophys. Res. Commun. 2003
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Co-expression (Functional linkage) M. Thakur, R. Chaba et al. Interdomain interaction reconstitutes the functionality of PknA, a eukaryotic type Ser/Thr kinase from Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Signaling Rv0015c	active	vmevada102	2012-10-05
	Co-expression (Functional linkage) M. Thakur, R. Chaba et al. Interdomain interaction reconstitutes the functionality of PknA, a eukaryotic type Ser/Thr kinase from Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Functional linkage (Co-expression) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Functional linkage (Co-expression) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Structural Analysis CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Structural Analysis A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Spectrophotometric CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Spectrophotometric A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	vmevada102	2012-10-05
	Affinity purification (Physical interaction) A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
Name	TRANSMEMBRANE SERINE/THREONINE-PROTEIN KINASE, known to phosphorylate KasA, KasB, FabH, InhA and Pks13	active	mjackson	2012-10-05
	Regulatory proteins