Rv0072 - glutamine-transport transmembrane protein ABC transporter

Expression: Most Significant Conditions for Rv0072

Protein Domains

Gene Information
Locus	Rv0072
Symbol
Gene Name	glutamine-transport transmembrane protein ABC transporter
Location	80624 - 81673 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1050 bp Protein:350 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	14058
Related Genes	MT0078
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0072
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0072 Transcript 1
MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEARHTVDSMGVDVFVVRS
GAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTSTRNVTVFGAPEHGPGM
PRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVPNSTALAKIPNVFLTTEG
LQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVRPLKVAVNSISIVAVLLWI
VAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQALVIALLAAVVGVVLAQVL
APLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTVDPAQAFGGP*

Genomic Sequence

>Rv0072
ATGCTCTTCGCGGCCCTGCGTGACATGCAATGGAGAAAGCGCCGCCTGGTCATCACGATC
ATCAGCACCGGGCTGATCTTCGGGATGACGCTTGTTTTGACCGGACTCGCGAACGGCTTC
CGGGTGGAGGCCCGGCACACCGTCGATTCCATGGGTGTCGATGTATTCGTCGTCAGATCC
GGCGCTGCTGGACCTTTTCTGGGTTCAATACCGTTTCCCGATGTTGACCTGGCCCGAGTG
GCCGCTGAACCCGGTGTCATGGCCGCGGCCCCGTTGGGCAGCGTGGGGACGATCATGAAA
GAAGGCACGTCGACGCGAAACGTCACGGTCTTCGGCGCGCCCGAGCACGGACCTGGCATG
CCACGGGTCTCAGAGGGTCGGTCACCGTCGAAACCGGACGAAGTCGCGGCATCGAGCACG
ATGGGCCGACACCTCGGTGACACTGTCGAGGTCGGCGCGCGCAGATTGCGGGTCGTTGGC
ATTGTGCCGAATTCCACCGCGCTGGCCAAGATCCCCAATGTCTTCCTCACGACCGAGGGC
TTACAGAAATTGGCGTACAACGGGCAGCCGAATATCACGTCCATCGGGATCATAGGTATG
CCCCGACAGCTGCCGGAGGGTTACCAGACTTTCGATCGGGTGGGCGCTGTCAATGATTTG
GTGCGCCCATTGAAGGTCGCAGTGAATTCGATCTCGATCGTGGCTGTTTTGCTGTGGATT
GTGGCGGTGCTGATCGTCGGCTCGGTGGTGTACCTTTCGGCTCTTGAGCGGCTACGTGAC
TTCGCGGTGTTCAAGGCGATTGGCACGCCAACGCGCTCGATTATGGCCGGGCTCGCATTA
CAGGCGCTGGTCATTGCGTTGCTTGCGGCGGTGGTGGGCGTCGTCCTGGCGCAGGTGTTG
GCACCACTGTTTCCGATGATTGTCGCGGTACCCGTCGGTGCTTACCTGGCGCTACCGGTG
GCCGCGATCGTCATCGGTCTGTTCGCTAGTGTTGCCGGATTGAAGCGCGTGGTGACGGTC
GATCCCGCGCAGGCGTTCGGAGGTCCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null