Rv0105c - 50S ribosomal protein rpmB1

Expression: Most Significant Conditions for Rv0105c

Protein Domains

Gene Information
Locus	Rv0105c
Symbol	rpmB1
Gene Name	50S ribosomal protein rpmB1
Location	123980 - 124264 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:285 bp Protein:95 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33408
Related Genes	CE0943 cg0991 DIP0851 jk1535 MAV_4875 Mkms_4817 Mmcs_4731 MSMEG_6068 MT0114 MT2118 MUL_4831 Mvan_5489 nfa49750 PPA2158 Rv2058c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0105c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0105c Transcript 1
MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVID
RDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL*

Genomic Sequence

>Rv0105c
ATGTCCGCCCGCTGCCAAATCACCGGCCGCACTGTGGGTTTCGGTAAGGCTGTGTCGCAC
TCACACCGCCGCACTCGGCGACGTTGGCCGCCCAATATCCAGCTCAAGGCCTACTACTTA
CCGTCGGAGGACCGCCGCATCAAGGTGCGGGTCAGCGCCCAAGGAATCAAGGTCATCGAC
CGCGACGGGCATCGAGGCCGTCGTCGCGCGGCTCGGGCAGGATCCGCCCCGGCGCACTTC
GCGCGCCAAGCGGGCTCATCGCTCCGAACGGCGGCGATCCTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2057c	active	raj252000	2012-10-05
	operon (Functional Linkage) authors,BA. Maguire,DG. Wild Mutations in the rpmBG operon of Escherichia coli that affect ribosome assembly. J. Bacteriol. 1997
Interaction	Regulatory Rv2359	active	prabhakarsmail	2012-10-05
	Footprinting A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	Regulatory Rv2359	active	akankshajain.21	2012-10-05
	Footprinting A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008