Rv0108c - hypothetical protein

Expression: Most Significant Conditions for Rv0108c

Protein Domains

Gene Information
Locus	Rv0108c
Symbol
Gene Name	hypothetical protein
Location	130895 - 131104 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:210 bp Protein:70 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8850
Related Genes	MAP3499c MAV_5217 MT0117 MUL_4825
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0108c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0108c Transcript 1
MVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVVLELESRVNHQLQVIEKSFPAGYH
VGRAHHRIL*

Genomic Sequence

>Rv0108c
TTGGTGCCCGTCGAAACATTGCACTCCGGTGACCCGATCACCGATGTCAACGGTGGCGGT
CAGCGGTACATCGTCCTTGAGTCGAAGACCGTCGGTGACAGCTGCGTGGTGCTCGAGCTG
GAGTCGAGAGTGAACCACCAGCTGCAGGTCATCGAGAAGTCCTTCCCGGCGGGTTACCAC
GTCGGCAGGGCCCACCACCGCATTTTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2069	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv2069	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008