Rv0288 - low molecular weight protein antigen 7 esxH

Expression: Most Significant Conditions for Rv0288

Protein Domains

Gene Information
Locus	Rv0288
Symbol	esxH
Gene Name	low molecular weight protein antigen 7 esxH
Location	351848 - 352138 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:291 bp Protein:97 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	14130
Related Genes	MAP3784 MAV_4865 Mkms_0386 ML2531 Mmcs_0377 MSMEG_0621 MT0301 MUL_1210 Mvan_0418
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0288
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0288 Transcript 1
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQ
AMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG*

Genomic Sequence

>Rv0288
ATGTCGCAAATCATGTACAACTACCCCGCGATGTTGGGTCACGCCGGGGATATGGCCGGA
TATGCCGGCACGCTGCAGAGCTTGGGTGCCGAGATCGCCGTGGAGCAGGCCGCGTTGCAG
AGTGCGTGGCAGGGCGATACCGGGATCACGTATCAGGCGTGGCAGGCACAGTGGAACCAG
GCCATGGAAGATTTGGTGCGGGCCTATCATGCGATGTCCAGCACCCATGAAGCCAACACC
ATGGCGATGATGGCCCGCGACACGGCCGAAGCCGCCAAATGGGGCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1349	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,MS. Siegrist,M. Unnikrishnan,MJ. McConnell,M. Borowsky,TY. Cheng,N. Siddiqi,SM. Fortune,DB. Moody,EJ. Rubin Mycobacterial Esx-3 is required for mycobactin-mediated iron acquisition. Proc. Natl. Acad. Sci. U.S.A. 2009
Interaction	PhysicalInteraction Rv0287	active	gaat3s	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv0287	active	gaat3s	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002