Rv0299 - hypothetical protein

Expression: Most Significant Conditions for Rv0299

Protein Domains

Gene Information
Locus	Rv0299
Symbol
Gene Name	hypothetical protein
Location	363476 - 363778 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:303 bp Protein:101 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6998
Related Genes	MT0313
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0299
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0299 Transcript 1
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPN
GTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC*

Genomic Sequence

>Rv0299
TTGATCGCTCCCGGCGACATCGCGCCGCGCCGCGACAGTGAACACGAGCTCTACGTCGCC
GTCTTGTCCAACGCGCTCCATCGGGCCGCGGACACCGGACGGGTGATCACCTGCCCATTC
ATTCCGGGCCGGGTCCCCGAGGATCTCTTGGCGATGGTGGTGGCGGTCGAGCAACCCAAC
GGCACGCTGCTGCCGGAACTCGTGCAGTGGCTTCATGTTGCCGCGCTCGGTGCGCCACTC
GGCAACGCGGGCGTGGCCGCCCTACGCGAGGCTGCCTCGGTCGTGACAGCTCTGCTCTGT
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0298	active	sourish10	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	Inhibits Rv0298	active	sourish10	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0298	active	ahal4789	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	Inhibits Rv0298	active	ahal4789	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0298	active	sourish10	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	Inhibits Rv0298	active	sourish10	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0298	active	ahal4789	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	Inhibits Rv0298	active	ahal4789	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009