Rv0374c - carbon monoxyde dehydrogenase small chain

Expression: Most Significant Conditions for Rv0374c

Protein Domains

Gene Information
Locus	Rv0374c
Symbol
Gene Name	carbon monoxyde dehydrogenase small chain
Location	451800 - 452279 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:480 bp Protein:160 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	27212
Related Genes	Mkms_0501 Mkms_0502 Mmcs_0490 Mmcs_0491 MSMEG_0745 MSMEG_0746 MT0388 MT0389 MUL_0115 MUL_0116 Rv0373c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0374c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0374c Transcript 1
MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCGTCVVEVDGVPVKSCT
MLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTPGMLITARALLDRNPDP
DEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS*

Genomic Sequence

>Rv0374c
ATGCAGGTGAACATGACGGTAAACGGCGAGCCCGTCACCGCCGAGGTCGAACCCCGGATG
CTGCTGGTCCATTTTCTCCGTGATCAGCTGCGGCTCACCGGAACTCACTGGGGCTGTGAT
ACCAGCAACTGCGGGACATGCGTGGTGGAGGTCGACGGCGTGCCGGTGAAATCCTGCACG
ATGCTCGCCGTGATGGCCTCCGGGCACAGCATCCGCACGGTAGAGGGCTTGGCTGGGCCC
GACGGCCAGCTCGACCCGGTGCAGGAAGGGTTCATGCGCTGCCACGGGCTGCAATGCGGC
TTCTGCACCCCGGGAATGCTGATTACCGCGCGCGCCCTGCTGGACCGCAACCCGGATCCC
GACGAGCAGACCATCCGGGAAGCGATCTCGGGGCAGATCTGCCGGTGCACCGGATACACC
ACGATCGTGCGCTCCATTCAGTGGGCGGCAGCGCACCAGACCGTAAAGGCGCAGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - IPI	active	njamshidi	2012-10-05
	See PMID: 12486050, 14660375 authors,GM. King Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. Appl. Environ. Microbiol. 2003
Term	TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - IPI	active	njamshidi	2012-10-05
	See PMID: 12486050, 14660375 authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
Term	TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - ISS	active	njamshidi	2012-10-05
	See PMID: 12486050, 14660375 authors,GM. King Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. Appl. Environ. Microbiol. 2003
Term	TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - ISS	active	njamshidi	2012-10-05
	See PMID: 12486050, 14660375 authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
Interaction	Regulatory Rv2027c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv3132c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv2027c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv3132c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008