Rv0549c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0549c

Protein Domains

Gene Information
Locus	Rv0549c
Symbol
Gene Name	conserved hypothetical protein
Location	640228 - 640641 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:414 bp Protein:138 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8879
Related Genes	MT0574
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0549c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0549c Transcript 1
MRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQ
RAGALTVAYVDAALEELRQVPVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLL
TTDERLARAWPSAHAIG*

Genomic Sequence

>Rv0549c
GTGAGAGCATCGCCCACTTCGCCGCCGGAGCAGGTGGTCGTCGACGCGAGTGCCATGGTG
GATCTACTGGCTCGCACTAGCGATCGGTGCTCTGCGGTGCGCGCGCGGCTGGCTCGGACC
GCGATGCACGCGCCGGCGCACTTCGATGCAGAGGTGTTGTCGGCGCTGGGGCGCATGCAG
CGCGCCGGCGCACTCACCGTTGCCTATGTCGATGCGGCACTGGAGGAGTTGCGACAGGTG
CCGGTGACTCGACACGGTCTTTCGTCGCTGCTTGCTGGAGCGTGGTCGCGCCGCGACACC
CTCCGCCTGACCGATGCCCTCTACGTCGAGCTGGCCGAAACGGCAGGTCTGGTGTTGTTG
ACCACCGACGAAAGATTGGCACGCGCCTGGCCCTCGGCTCACGCCATCGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0550c	active	sourish10	2012-10-05
	Spectrophototmetric assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0550c	active	sourish10	2012-10-05
	Spectrophototmetric assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	VapC	active	jlew	2012-03-07
	Growth inhibitory in Mt and MS. authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC3	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to Rv0960, Rv0065, and Rv1720c from Mycobacterium tuberculosis.
Other	stop:640641	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to Rv0960, Rv0065, and Rv1720c from Mycobacterium tuberculosis.
Other	start:640228	active	rslayden	2012-03-05
	Predicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to Rv0960, Rv0065, and Rv1720c from Mycobacterium tuberculosis.