Rv0550c - hypothetical protein

Expression: Most Significant Conditions for Rv0550c

Protein Domains

Gene Information
Locus	Rv0550c
Symbol
Gene Name	hypothetical protein
Location	640638 - 640904 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:267 bp Protein:89 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8880
Related Genes	MT0575
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0550c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0550c Transcript 1
MLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQAAISAELENSATDAWL
EGLEPRSTGARHDDVLGAIDAARDEFEA*

Genomic Sequence

>Rv0550c
TTGTTGAGCCGGCGCACGAAAACGATCGTTGTGTGTACATTGGTGTGTATGGCTCGGTTG
AACGTGTATGTGCCCGACGAATTGGCGGAGCGCGCCAGGGCGCGGGGCTTGAACGTCTCG
GCGCTGACTCAGGCCGCGATCAGTGCCGAGTTGGAGAACTCCGCAACCGATGCGTGGCTT
GAGGGGTTGGAACCCAGAAGCACCGGCGCTCGGCATGATGACGTGCTGGGTGCGATCGAT
GCCGCTCGCGATGAGTTCGAAGCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv0549c	active	sourish10	2012-10-05
	Spectrophototmetric assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv0549c	active	sourish10	2012-10-05
	Spectrophototmetric assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	VapB	active	jlew	2012-03-07
	Rescues growth inhibition in MS authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB3	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid. General function prediction only.
Other	stop:640904	active	rslayden	2012-03-05
	Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid. General function prediction only.
Other	start:640638	active	rslayden	2012-03-05
	Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid. General function prediction only.
Symbol	Vap BC-3	active	rslayden	2012-03-05
	Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid. General function prediction only.