Rv0644c - methoxy mycolic acid synthase 2 mmaA2

Expression: Most Significant Conditions for Rv0644c

Protein Domains

Gene Information
Locus	Rv0644c
Symbol	mmaA2
Gene Name	methoxy mycolic acid synthase 2 mmaA2
Location	738297 - 739160 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:864 bp Protein:288 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34019
Related Genes	MAP4117c MAV_4516 Mkms_0969 Mkms_0970 ML1900 Mmcs_0951 Mmcs_0952 MSMEG_1350 MSMEG_1351 MT0672 MUL_0731 Mvan_1239
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0644c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0644c Transcript 1
MVNDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQIAKIDLALGKL
GLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAHVQKSFDEMDTPRDRRVLL
AGWEQFNEPVDRIVSIGAFEHFGHDRHADFFARAHKILPPDGVLLLHTITGLTRQQMVDH
GLPLTLWLARFLKFIATEIFPGGQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWA
EALQEHKSEAIAIQSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK*

Genomic Sequence

>Rv0644c
ATGGTCAACGACCTAACGCCGCACTTCGAGGACGTGCAGGCACACTACGACCTGTCCGAC
GACTTCTTCCGGCTGTTCCTGGATCCGACCCAGACCTACAGCTGCGCGCATTTCGAACGC
GAGGACATGACGCTGGAAGAGGCCCAGATCGCCAAGATCGACCTGGCGCTGGGCAAGCTA
GGTCTGCAGCCCGGCATGACGCTGCTCGATATCGGTTGCGGCTGGGGCGCCACCATGCGG
CGCGCGATCGCGCAGTATGACGTCAACGTCGTCGGCCTGACATTGTCGAAGAACCAGGCC
GCCCATGTGCAGAAGTCGTTCGACGAGATGGACACCCCGCGCGACAGGCGAGTGTTGCTG
GCGGGATGGGAGCAGTTCAACGAGCCCGTCGACCGCATCGTGTCGATCGGCGCGTTCGAG
CACTTCGGCCACGATCGTCACGCCGACTTCTTCGCCCGGGCCCACAAAATCCTGCCGCCC
GATGGCGTGTTGCTGCTGCACACGATCACCGGCCTGACCAGGCAGCAGATGGTCGACCAC
GGCTTGCCGCTCACGTTGTGGCTGGCCCGCTTTCTCAAGTTCATCGCGACCGAAATCTTC
CCGGGGGGCCAACCTCCGACGATTGAAATGGTTGAGGAACAGTCGGCGAAGACGGGTTTC
ACGCTGACTCGCCGCCAGTCGCTGCAGCCGCATTACGCCAGGACCCTCGACCTGTGGGCC
GAGGCGCTGCAGGAACACAAAAGCGAGGCCATCGCGATCCAGTCCGAAGAGGTCTACGAG
CGGTACATGAAATACCTGACCGGCTGCGCCAAGCTGTTCCGGGTCGGCTACATCGACGTC
AACCAGTTCACGCTGGCGAAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC5 Mycolic Acid Cyclopropanation - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC5 Mycolic Acid Cyclopropanation - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC4 Mycolic Acid Cyclopropanation - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC4 Mycolic Acid Cyclopropanation - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Name	MmaA2 METHOXY MYCOLIC ACID SYNTHASE, adds the cyclopropane rings to the distal positions of the alpha mycolate	active	mjackson	2012-10-05
	S-adenosyl-methionine-dependent mycolic acid methyltransferases
Term	EC:2.1.1.79 Cyclopropane-fatty-acyl-phospholipid synthase. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant MS. Glickman The mmaA2 gene of Mycobacterium tuberculosis encodes the distal cyclopropane synthase of the alpha-mycolic acid. J. Biol. Chem. 2003
Term	EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant MS. Glickman The mmaA2 gene of Mycobacterium tuberculosis encodes the distal cyclopropane synthase of the alpha-mycolic acid. J. Biol. Chem. 2003
Term	EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005