Rv0660c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0660c

Protein Domains

Gene Information
Locus	Rv0660c
Symbol
Gene Name	conserved hypothetical protein
Location	754980 - 755225 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:246 bp Protein:82 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8896
Related Genes	MT0689
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0660c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0660c Transcript 1
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENA
LAEIADWGPAEDWADWADAAR*

Genomic Sequence

>Rv0660c
ATGCTCAGCTTCCGCGCCGACGACCACGACGTCGACCTGGCCGACGCGTGGGCGCGTCGC
CTACACATCGGCCGCTCCGAGCTGCTGCGCGATGCGCTGCGACGTCACTTGGCCGCGCTG
GCCGCGGACCAGGATGTCCAGGCCTACACCGAGCGACCGTTGACGGACGACGAGAACGCA
CTGGCTGAGATCGCCGACTGGGGGCCGGCGGAGGACTGGGCCGACTGGGCCGATGCGGCG
CGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0659c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Inhibits Rv0659c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0659c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Inhibits Rv0659c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0659c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Inhibits Rv0659c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0659c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Inhibits Rv0659c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	MazE2	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to AF016485_130 from Halo bacterium sp (100 aa), FASTA scores: (32.4% identity in 74 aa overlap)
Other	stop:755225	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to AF016485_130 from Halo bacterium sp (100 aa), FASTA scores: (32.4% identity in 74 aa overlap)
Other	start:754980	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to AF016485_130 from Halo bacterium sp (100 aa), FASTA scores: (32.4% identity in 74 aa overlap)
Symbol	mazEF-2	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to AF016485_130 from Halo bacterium sp (100 aa), FASTA scores: (32.4% identity in 74 aa overlap)