Rv0684 - elongation factor G fusA1

Expression: Most Significant Conditions for Rv0684

Protein Domains

Gene Information
Locus	Rv0684
Symbol	fusA1
Gene Name	elongation factor G fusA1
Location	782485 - 784590 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2106 bp Protein:702 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37068
Related Genes	CE0516 cg0583 DIP0469 jk1840 MAP4142 MAV_4490 Mkms_1004 Mmcs_0986 MT0700 MT0712 MUL_0752 MUL_0765 Mvan_1281 nfa50760 Rv0671
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0684
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0684 Transcript 1
MAQKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGEVHDGAATMDWMEQEQ
ERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSE
QVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMGERLGANAVPIQLPVGAEADFEGVVD
LVEMNAKVWRGETKLGETYDTVEIPADLAEQAEEYRTKLLEVVAESDEHLLEKYLGGEEL
TVDEIKGAIRKLTIASEIYPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPPAIGHAPAKE
DEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSGTVESGSQVINATKGKKERLGKL
FQMHSNKENPVDRASAGHIYAVIGLKDTTTGDTLSDPNQQIVLESMTFPDPVIEVAIEPK
TKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREFKVEANV
GKPQVAYKETIKRLVQNVEYTHKKQTGGSGQFAKVIINLEPFTGEEGATYEFESKVTGGR
IPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAYHEVDSSEMAFKIAGSQVLKKA
AALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERAGARVVRAHVPLSEMF
GYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEIIAKATGE*

Genomic Sequence

>Rv0684
GTGGCACAGAAGGACGTGCTGACCGACCTGAGTAGGGTCCGCAACTTCGGCATCATGGCG
CACATCGATGCCGGCAAGACCACAACCACCGAGCGCATCCTGTACTACACCGGTATCAAC
TACAAGATTGGTGAGGTGCACGACGGCGCAGCCACCATGGACTGGATGGAACAGGAACAG
GAGCGCGGCATCACCATCACCTCTGCGGCCACGACCACGTTCTGGAAAGACAACCAGCTC
AATATCATCGACACGCCAGGGCATGTGGATTTCACCGTCGAGGTGGAGCGCAATCTGCGC
GTGCTCGACGGCGCGGTCGCGGTTTTCGACGGCAAAGAGGGTGTCGAACCGCAGTCCGAA
CAGGTGTGGCGGCAGGCCGACAAATACGATGTCCCCCGAATCTGCTTCGTCAACAAGATG
GACAAGATCGGTGCGGACTTCTACTTCTCGGTTCGCACGATGGGGGAGCGGCTTGGGGCC
AACGCCGTGCCCATTCAGCTTCCCGTCGGTGCGGAGGCCGACTTCGAAGGCGTCGTCGAC
CTGGTGGAGATGAACGCCAAGGTGTGGCGCGGCGAGACGAAACTCGGCGAAACCTACGAC
ACCGTGGAAATACCGGCCGACCTGGCCGAGCAGGCTGAGGAGTACCGGACCAAGCTGCTC
GAGGTGGTCGCCGAGTCCGACGAGCACCTGTTGGAGAAGTACCTGGGCGGTGAGGAGCTC
ACCGTCGACGAGATCAAGGGCGCGATCCGCAAGCTGACAATCGCCAGCGAGATCTACCCG
GTGCTGTGCGGCAGCGCGTTCAAGAACAAGGGCGTGCAGCCGATGCTGGATGCCGTCGTC
GACTACCTGCCGTCGCCGCTGGACGTTCCGCCGGCGATCGGGCACGCGCCCGCCAAGGAG
GACGAGGAGGTGGTGCGCAAGGCGACCACCGACGAGCCCTTTGCGGCCCTGGCGTTCAAG
ATCGCTACTCACCCGTTCTTCGGCAAGCTCACCTACATCCGGGTGTACTCGGGCACCGTC
GAGTCGGGTAGCCAGGTCATCAATGCCACCAAGGGCAAGAAAGAACGGCTGGGCAAGCTG
TTCCAGATGCACTCCAACAAGGAGAACCCGGTCGATAGGGCTAGTGCCGGTCACATCTAC
GCGGTGATCGGTCTCAAGGACACCACCACCGGTGACACCTTGAGCGACCCGAACCAGCAG
ATCGTGCTGGAGTCGATGACCTTCCCCGACCCGGTGATCGAGGTGGCCATCGAGCCGAAG
ACCAAGAGCGACCAAGAGAAGCTGAGTCTGTCGATCCAGAAGCTCGCCGAAGAGGATCCG
ACCTTCAAGGTGCACCTGGATTCCGAGACCGGCCAGACCGTCATCGGCGGCATGGGCGAG
CTGCATCTGGACATCCTGGTGGACCGCATGCGCCGGGAATTCAAGGTCGAGGCCAACGTC
GGCAAGCCTCAGGTTGCCTACAAGGAGACCATCAAGCGGCTCGTGCAGAACGTCGAGTAC
ACCCACAAGAAGCAGACGGGTGGCTCGGGCCAGTTCGCCAAGGTCATCATCAACCTCGAG
CCGTTCACCGGTGAAGAGGGCGCGACCTACGAGTTCGAGAGCAAAGTCACCGGCGGGCGT
ATCCCGCGGGAGTACATCCCGTCGGTGGATGCCGGCGCACAGGACGCCATGCAGTACGGC
GTGCTGGCCGGCTATCCGCTGGTGAACCTGAAGGTCACGCTGCTCGACGGCGCCTACCAC
GAGGTTGACTCCTCGGAAATGGCGTTCAAGATCGCGGGCTCGCAGGTGCTCAAAAAGGCT
GCCGCACTTGCGCAGCCGGTGATCCTGGAACCGATCATGGCGGTCGAGGTGACCACACCC
GAGGACTACATGGGTGACGTGATCGGCGACCTGAACTCCCGCCGTGGCCAGATCCAGGCC
ATGGAGGAGCGGGCTGGTGCGCGCGTTGTTAGGGCGCACGTGCCGCTGTCGGAGATGTTC
GGCTACGTCGGTGACCTTCGGTCCAAGACTCAAGGCCGGGCAAACTACTCCATGGTGTTC
GACTCGTACTCCGAAGTGCCGGCGAACGTGTCGAAGGAAATCATCGCGAAGGCGACGGGC
GAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2882c	active	shahanup86	2012-10-05
	Structural Analysis AR. Rao & U. Varshney Specific interaction between the ribosome recycling factor and the elongation factor G from Mycobacterium tuberculosis mediates peptidyl-tRNA release and ribosome recycling in Escherichia coli. EMBO J. 2001
Interaction	PhysicalInteraction Rv2882c	active	shahanup86	2012-10-05
	Spectrophotometric AR. Rao & U. Varshney Specific interaction between the ribosome recycling factor and the elongation factor G from Mycobacterium tuberculosis mediates peptidyl-tRNA release and ribosome recycling in Escherichia coli. EMBO J. 2001
Interaction	Transcription Rv0348	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv3414c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0348	active	sourish10	2012-10-05
	Co-expression (Functional linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv3414c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Structural Analysis authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Spectrophotometric authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Gao,AV. Zavialov,M. Ehrenberg,J. Frank Specific interaction between EF-G and RRF and its implication for GTP-dependent ribosome splitting into subunits. J. Mol. Biol. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001