Rv0863 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0863

Protein Domains

Gene Information
Locus	Rv0863
Symbol
Gene Name	conserved hypothetical protein
Location	962599 - 962880 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:282 bp Protein:94 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	372
Related Genes	CE0893 cg0935 DIP0774 jk0415 MAP0801 MAV_0992 Mkms_4570 ML2155 Mmcs_4483 MSMEG_5704 MT0886 MUL_0287 Mvan_5053 nfa6360
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0863
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0863 Transcript 1
MCSVIADQRRPDQPCGVGGCKTCQNGFVADIAEGKARKTRYVDHGWPTTDPDDHAVSELV
TDRTGALSPFGELTFPVPSDDLPYIHPVTVINR*

Genomic Sequence

>Rv0863
GTGTGTTCGGTCATTGCTGATCAGCGTAGGCCGGACCAGCCTTGTGGCGTGGGCGGGTGC
AAGACCTGTCAGAATGGTTTCGTGGCTGACATTGCTGAAGGTAAGGCACGCAAGACCAGG
TACGTGGACCATGGTTGGCCGACCACCGATCCAGACGACCATGCGGTGAGCGAACTCGTG
ACCGACCGCACGGGTGCGCTATCACCCTTCGGTGAATTGACGTTCCCGGTACCGTCCGAC
GACCTGCCCTACATCCACCCGGTGACCGTCATCAATCGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2710	active	swetha.r	2012-10-05
	Co-expression (Functional linkage) JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	Regulatory Rv1221	active	swetha.r	2012-10-05
	Co-expression (Functional linkage) JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	Regulatory Rv2710	active	swetha.r	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv1221	active	swetha.r	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001