Rv0868c - molybdenum cofactor biosynthesis protein D 2 moaD2

Expression: Most Significant Conditions for Rv0868c

Protein Domains

Gene Information
Locus	Rv0868c
Symbol	moaD2
Gene Name	molybdenum cofactor biosynthesis protein D 2 moaD2
Location	965983 - 966261 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:279 bp Protein:93 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	66
Related Genes	Acel_2024 CE0190 cg0264 MAP0806c MAV_0997 Mkms_4565 Mmcs_4478 MSMEG_5699 MT0891 MUL_0282 Mvan_5048 nfa43150 PPA0501 RHA1_ro06430 SAV4040
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0868c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0868c Transcript 1
MTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSR
CSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG*

Genomic Sequence

>Rv0868c
GTGACGCAGGTGTCCGACGAATCCGCCGGAATTCAGGTGACTGTCCGCTACTTCGCGGCC
GCCCGAGCGGCCGCTGGTGCCGGGTCGGAGAAAGTCACCCTGCGATCTGGCGCCACAGTC
GCCGAGCTGATAGACGGCCTGTCGGTCCGCGATGTTCGCCTCGCGACGGTGTTGAGTCGA
TGCTCCTACCTGCGCGACGGGATTGTCGTCCGAGATGACGCCGTCGCGTTATCCGCCGGC
GACACGATTGACGTACTACCCCCTTTCGCCGGCGGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	ActivatedBy Rv3323c	active	vashishtrv	2012-10-05
	Domain Fusion(Functional-linkage) authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Interaction	ActivatedBy Rv3323c	active	shahanup86	2012-10-05
	Domain Fusion(Functional-linkage) authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Interaction	PhysicalInteraction Rv3116	active	kaveri.verma	2012-10-05
	Structural Analysis CT. Jurgenson, KE. Burns et al. Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis. Biochemistry 2008
Interaction	Activation Rv3025c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
Interaction	Activation Rv3206c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
Interaction	Activation Rv3025c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
Interaction	Activation Rv3206c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
Interaction	Activation Rv3025c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,W. Zhang,A. Urban,H. Mihara,S. Leimkühler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
Interaction	Activation Rv3206c	active	girishgene07	2012-10-05
	co-occurrence (functional linkage) authors,W. Zhang,A. Urban,H. Mihara,S. Leimkühler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
Interaction	PhysicalInteraction Rv0866	active	sourish10	2012-10-05
	EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv0866	active	sourish10	2012-10-05
	authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv0866	active	ahal4789	2012-10-05
	EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv0866	active	ahal4789	2012-10-05
	authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004