Rv0916c - PE family protein

Expression: Most Significant Conditions for Rv0916c

Protein Domains

Gene Information
Locus	Rv0916c
Symbol	PE7
Gene Name	PE family protein
Location	1021344 - 1021643 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:300 bp Protein:100 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8916
Related Genes	MT0941
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0916c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0916c Transcript 1
MSFVTIQPVVLAAATGDLPTIGTAVSARNTAVCAPTTGVLPPAANDVSVLTAARFTAHTK
HYRVVSKPAALVHGMFVALPAATADAYATTEAVNVVATG*

Genomic Sequence

>Rv0916c
ATGTCTTTTGTGACCATCCAGCCGGTGGTCTTGGCAGCCGCGACGGGGGACTTGCCGACG
ATCGGTACCGCCGTGAGTGCTCGGAACACAGCCGTCTGTGCCCCGACGACGGGGGTGTTA
CCCCCTGCTGCCAATGACGTGTCGGTCCTGACGGCGGCCCGGTTCACCGCGCACACCAAG
CACTACCGAGTGGTGAGTAAGCCGGCCGCGCTGGTCCATGGCATGTTCGTGGCCCTCCCG
GCGGCCACCGCCGATGCGTATGCGACCACCGAGGCCGTCAATGTGGTCGCGACCGGTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) MI. Voskuil,D. Schnappinger,R. Rutherford,Y. Liu,GK. Schoolnik Regulation of the Mycobacterium tuberculosis PE/PPE genes. Tuberculosis (Edinb) 2004
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) YA. Skeiky, PJ. Ovendale et al. T cell expression cloning of a Mycobacterium tuberculosis gene encoding a protective antigen associated with the early control of infection. J. Immunol. 2000
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) MI. Voskuil,D. Schnappinger,R. Rutherford,Y. Liu,GK. Schoolnik Regulation of the Mycobacterium tuberculosis PE/PPE genes. Tuberculosis (Edinb) 2004
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Signaling Rv0915c	active	soumisengupta	2012-10-05
	Co-expression (Functional Linkage) YA. Skeiky, PJ. Ovendale et al. T cell expression cloning of a Mycobacterium tuberculosis gene encoding a protective antigen associated with the early control of infection. J. Immunol. 2000
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003