Rv1031 - potassium-transporting ATPase C chain kdpC

Expression: Most Significant Conditions for Rv1031

Protein Domains

Gene Information
Locus	Rv1031
Symbol	kdpC
Gene Name	potassium-transporting ATPase C chain kdpC
Location	1155853 - 1156422 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:570 bp Protein:190 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2293
Related Genes	jk1271 MAP0997c MAV_1171 Mkms_4294 Mmcs_4228 MSMEG_5394 MT1060 Mvan_4761 nfa15680 PPA0117 SAV917
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1031
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1031 Transcript 1
MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQF
TAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVD
AVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVL
RLNLALDRL*

Genomic Sequence

>Rv1031
ATGCGTCGTCAATTACTGCCCGCGCTCACCATGCTGTTGGTGTTCACCGTCATCACCGGC
ATCGTCTACCCGCTTGCCGTGACCGGCGTCGGGCAACTGTTCTTCGGTGACCAGGCGAAC
GGCGCGCTGCTCGAGCGGGACGGGCAGGTCATCGGCTCCGCCCACATCGGCCAGCAGTTC
ACCGCCGCGAAGTACTTCCACCCGCGCCCCTCGTCGGCAGGCGACGGTTACGACGCTGCG
GCGAGCTCGGGCTCCAACCTGGGACCGACGAACGAGAAGCTGCTGGCGGCCGTCGCTGAA
CGGGTCACCGCCTACCGCAAGGAAAACAATCTGCCGGCCGATACGCTGGTTCCGGTCGAC
GCGGTTACCGGCTCGGGTTCCGGGCTGGACCCGGCCATATCGGTGGTCAATGCCAAGCTG
CAGGCACCGCGGGTGGCGCAGGCGCGCAATATCTCGATAAGGCAGGTCGAGCGTCTGATC
GAGGACCACACCGACGCGCGTGGTCTCGGCTTCCTGGGCGAGCGCGCGGTGAACGTGCTC
AGGCTGAACCTCGCATTGGATCGCCTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1029	active	darhngu	2012-10-05
	Affinity purification authors,M. Gassel,A. Siebers,W. Epstein,K. Altendorf Assembly of the Kdp complex, the multi-subunit K+-transport ATPase of Escherichia coli. Biochim. Biophys. Acta 1998
Interaction	PhysicalInteraction Rv1029	active	darhngu	2012-10-05
	Affinity purification M. Gassel & K. Altendorf Analysis of KdpC of the K(+)-transporting KdpFABC complex of Escherichia coli. Eur. J. Biochem. 2001
Interaction	PhysicalInteraction Rv1029	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	PhysicalInteraction Rv1029	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	PhysicalInteraction Rv1028A	active	akankshajain.21	2012-10-05
	Deletion analysis authors,M. Gassel,T. Möllenkamp,W. Puppe,K. Altendorf The KdpF subunit is part of the K(+)-translocating Kdp complex of Escherichia coli and is responsible for stabilization of the complex in vitro. J. Biol. Chem. 1999
Interaction	PhysicalInteraction Rv1028A	active	akankshajain.21	2012-10-05
	Deletion analysis authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1027c	active	sourish10	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	Signaling Rv1027c	active	ahal4789	2012-10-05
	authors,A. Ballal,B. Basu,SK. Apte The Kdp-ATPase system and its regulation. J. Biosci. 2007
Interaction	RegulatedBy Rv1027c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1027c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006